PDB entry 3uzp

View 3uzp on RCSB PDB site
Description: crystal structure of ck1d with PF670462 from P21 crystal form
Class: transferase/transferase inhibitor
Keywords: ck1d, kinase, inhibitor, PF670462, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2011-12-07, released 2012-01-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-11-14, with a file datestamp of 2012-11-09.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.222
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Casein kinase I isoform delta
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK1D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3uzpa_
  • Chain 'B':
    Compound: Casein kinase I isoform delta
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK1D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3uzpb_
  • Heterogens: 0CK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3uzpA (A:)
    gsmelrvgnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykm
    mqggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisriey
    ihsknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtar
    yasinthlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpie
    vlckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uzpA (A:)
    lrvgnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmqgg
    vgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihsk
    nfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtaryasi
    nthlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievlck
    gypsefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3uzpB (B:)
    gsmelrvgnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykm
    mqggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisriey
    ihsknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtar
    yasinthlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpie
    vlckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uzpB (B:)
    lrvgnryrlgrkigsgdiylgtdiaageevaiklecvkthieskiykmmqggvgiptirw
    cgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihsknfihrdvk
    pdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtaryasinthlgieq
    srrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievlckgypsefat
    ylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlk