PDB entry 3uyt

View 3uyt on RCSB PDB site
Description: crystal structure of ck1d with PF670462 from P1 crystal form
Class: transferase/transferase inhibitor
Keywords: ck1d, kinase, inhibitor, PF670462, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2011-12-06, released 2012-01-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-11-14, with a file datestamp of 2012-11-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.244
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Casein kinase I isoform delta
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK1D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3uyta_
  • Chain 'B':
    Compound: Casein kinase I isoform delta
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK1D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3uytb_
  • Chain 'C':
    Compound: Casein kinase I isoform delta
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK1D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3uytc_
  • Chain 'D':
    Compound: Casein kinase I isoform delta
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK1D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3uytd_
  • Heterogens: 0CK, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3uytA (A:)
    gsmelrvgnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykm
    mqggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisriey
    ihsknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtar
    yasinthlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpie
    vlckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uytA (A:)
    vgnryrlgrkigsgsfgdiylgtdiaageevaiklecvkpqlhieskiykmmqggvgipt
    irwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihsknfihr
    dvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtaryasinthlg
    ieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievlckgypse
    fatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3uytB (B:)
    gsmelrvgnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykm
    mqggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisriey
    ihsknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtar
    yasinthlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpie
    vlckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uytB (B:)
    vgnryrlgrkigsgsfgdiylgtdiaageevaiklecvkpqlhieskiykmmqggvgipt
    irwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihsknfihr
    dvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtaryasinthlg
    ieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievlckgypse
    fatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnml
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3uytC (C:)
    gsmelrvgnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykm
    mqggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisriey
    ihsknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtar
    yasinthlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpie
    vlckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uytC (C:)
    rvgnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmqggv
    giptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihskn
    fihrdvkpdnflmglgkkgnlvyiidfglakkyrdhipyrenknltgtaryasinthlgi
    eqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievlckgypsef
    atylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3uytD (D:)
    gsmelrvgnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykm
    mqggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisriey
    ihsknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtar
    yasinthlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpie
    vlckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uytD (D:)
    rvgnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmqggv
    giptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihskn
    fihrdvkpdnflmglgkkgnlvyiidfglakkyrtgtaryasinthlgieqsrrddlesl
    gyvlmyfnlgslpwqglkyerisekkmstpievlckgypsefatylnfcrslrfddkpdy
    sylrqlfrnlfhrqgfsydyvfdwnmlk