PDB entry 3uys

View 3uys on RCSB PDB site
Description: Crystal structure of apo human ck1d
Class: transferase
Keywords: ck1d, kinase, PF670462, TRANSFERASE
Deposited on 2011-12-06, released 2012-01-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-11-14, with a file datestamp of 2012-11-09.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.238
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Casein kinase I isoform delta
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK1D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3uysa_
  • Chain 'B':
    Compound: Casein kinase I isoform delta
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK1D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3uysb_
  • Chain 'C':
    Compound: Casein kinase I isoform delta
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK1D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3uysc_
  • Chain 'D':
    Compound: Casein kinase I isoform delta
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK1D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3uysd_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3uysA (A:)
    gsmelrvgnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykm
    mqggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisriey
    ihsknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtar
    yasinthlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpie
    vlckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uysA (A:)
    rvgnryrlgrkgdiylgtdiaageevaiklecvpqlhieskiykmmqggvgiptirwcga
    egdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihsknfihrdvkpdn
    flmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtaryasinthlgieqsrr
    ddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievlckgypsefatyln
    fcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3uysB (B:)
    gsmelrvgnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykm
    mqggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisriey
    ihsknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtar
    yasinthlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpie
    vlckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uysB (B:)
    rvgnryrlgrkiylgtdiaageevaiklecvpqlhieskiykmmqggvgiptirwcgaeg
    dynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihsknfihrdvkpdnfl
    mglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtaryasinthlgieqsrrdd
    leslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievlckgypsefatylnfc
    rslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3uysC (C:)
    gsmelrvgnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykm
    mqggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisriey
    ihsknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtar
    yasinthlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpie
    vlckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uysC (C:)
    rvgnryrlgrkigsgfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmqggvg
    iptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihsknf
    ihrdvkpdnflmglgkkgnlvyiidfglakkyrdahipyrenknltgtaryasinthlgi
    eqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievlckgypsef
    atylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3uysD (D:)
    gsmelrvgnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykm
    mqggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisriey
    ihsknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtar
    yasinthlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpie
    vlckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uysD (D:)
    rvgnryrlgrkigsdiylgtdiaageevaiklecvkpqlhieskiykmmqggvgiptirw
    cgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihsknfihrdvk
    pdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtaryasinthlgieq
    srrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievlckgypsefat
    ylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlk