PDB entry 3uyo

View 3uyo on RCSB PDB site
Description: Crystal structure of monobody SH13/ABL1 SH2 domain complex
Class: signaling protein/protein binding
Keywords: engineered binding protein, antibody mimic, protein-protein complex, SH2 domain, ATP-binding, phosphoprotein, tyrosine-protein kinase, signaling protein-protein binding complex
Deposited on 2011-12-06, released 2011-12-28
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: 0.19
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase ABL1
    Species: Homo sapiens [TaxId:9606]
    Gene: ABL, ABL1, JTK7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3uyoa_
  • Chain 'D':
    Compound: Monobody SH13
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3UYO (Start-94)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3uyoA (A:)
    gspsnyitpvnslekhswyhgpvsrnaaeyllssgingsflvresesspgqrsislryeg
    rvyhyrintasdgklyvssesrfntlaelvhhhstvadglittlhypapkrnkptvygvs
    pny
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uyoA (A:)
    yitpvnslekhswyhgpvsrnaaeyllssgingsflvresesspgqrsislryegrvyhy
    rintasdgklyvssesrfntlaelvhhhstvadglittlhypapkrnkptvygv
    

  • Chain 'D':
    No sequence available.