PDB entry 3uyo
View 3uyo on RCSB PDB site
Description: Crystal structure of monobody SH13/ABL1 SH2 domain complex
Class: signaling protein/protein binding
Keywords: engineered binding protein, antibody mimic, protein-protein complex, SH2 domain, ATP-binding, phosphoprotein, tyrosine-protein kinase, signaling protein-protein binding complex
Deposited on
2011-12-06, released
2011-12-28
The last revision prior to the SCOPe 2.01 freeze date was dated
2011-12-28, with a file datestamp of
2011-12-23.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: 0.19
AEROSPACI score: 0.5
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Tyrosine-protein kinase ABL1
Species: Homo sapiens [TaxId:9606]
Gene: ABL, ABL1, JTK7
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d3uyoa_ - Chain 'D':
Compound: Monobody SH13
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Heterogens: SO4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3uyoA (A:)
gspsnyitpvnslekhswyhgpvsrnaaeyllssgingsflvresesspgqrsislryeg
rvyhyrintasdgklyvssesrfntlaelvhhhstvadglittlhypapkrnkptvygvs
pny
Sequence, based on observed residues (ATOM records): (download)
>3uyoA (A:)
yitpvnslekhswyhgpvsrnaaeyllssgingsflvresesspgqrsislryegrvyhy
rintasdgklyvssesrfntlaelvhhhstvadglittlhypapkrnkptvygv
- Chain 'D':
No sequence available.