PDB entry 3uy4

View 3uy4 on RCSB PDB site
Description: Crystal Structure of Pantoate--Beta-Alanine Ligase from Campylobacter jejuni complexed with AMP and vitamin B5
Class: ligase
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, alpha-beta-alpha structure, cytosol, LIGASE
Deposited on 2011-12-05, released 2011-12-28
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.172
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pantothenate synthetase
    Species: Campylobacter jejuni subsp. jejuni [TaxId:192222]
    Gene: Cj0297c, panC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9PIK2 (3-284)
      • expression tag (2)
    Domains in SCOPe 2.01: d3uy4a_
  • Heterogens: AMP, PAU, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3uy4A (A:)
    snamqvitsvkeakqivkdwkshqlsigyvptmgflhdghlslvkhaktqdkvivsifvn
    pmqfgpnedfssyprdlerdikmcqdngvdmvfipdatqmylknfstyvdmntitdklcg
    akrpghfrgvctvltkffnilnpdivymgqkdaqqcvvvrhmvddlnfdlkiqicpiire
    edglakssrnvylskeerkaslaisqsiflaeklvregekntskiiqamkdilekeklik
    idyielvdfntmenienitdnvlgavaafvgktrlidnflvqglk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uy4A (A:)
    amqvitsvkeakqivkdwkshqlsigyvptmgflhdghlslvkhaktqdkvivsifvnpm
    qfgpnedfssyprdlerdikmcqdngvdmvfipdatqmylknfstyvdmntitdklcgak
    rpghfrgvctvltkffnilnpdivymgqkdaqqcvvvrhmvddlnfdlkiqicpiireed
    glakssrnvylskeerkaslaisqsiflaeklvregekntskiiqamkdilekeklikid
    yielvdfntmenienitdnvlgavaafvgktrlidnflvqglk