PDB entry 3uxn

View 3uxn on RCSB PDB site
Description: Crystal Structure of Rat DNA Polymerase Beta, Wild Type Apoenzyme
Class: transferase
Keywords: DNA Polymerase, Base Excision Repair, TRANSFERASE
Deposited on 2011-12-05, released 2012-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-28, with a file datestamp of 2013-08-23.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.255
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase beta
    Species: Rattus norvegicus [TaxId:10116]
    Gene: POLB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3uxna1, d3uxna2, d3uxna3
  • Chain 'B':
    Compound: DNA polymerase beta
    Species: Rattus norvegicus [TaxId:10116]
    Gene: POLB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3uxnb1, d3uxnb2, d3uxnb3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3uxnA (A:)
    mskrkapqetlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeak
    klpgvgtkiaekideflatgklrklekirqddtsssinfltrvtgigpsaarklvdegik
    tledlrknedklnhhqriglkyfedfekripreemlqmqdivlnevkkldpeyiatvcgs
    frrgaessgdmdvllthpnftsesskqpkllhrvveqlqkvrfitdtlskgetkfmgvcq
    lpsendeneyphrridirlipkdqyycgvlyftgsdifnknmrahalekgftineytirp
    lgvtgvageplpvdseqdifdyiqwryrepkdrse
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uxnA (A:)
    tlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtki
    aekideflatgklrklekirqddtsssinfltrvtgigpsaarklvdegiktledlrkne
    dklnhhqriglkyfedfekripreemlqmqdivlnevkkldpeyiatvcgsfrrgaessg
    dmdvllthpnftsesskqpkllhrvveqlqkvrfitdtlskgetkfmgvcqlpsendene
    yphrridirlipkdqyycgvlyftgsdifnknmrahalekgftineytirplgvtgvage
    plpvdseqdifdyiqwryrepkdrs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3uxnB (B:)
    mskrkapqetlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeak
    klpgvgtkiaekideflatgklrklekirqddtsssinfltrvtgigpsaarklvdegik
    tledlrknedklnhhqriglkyfedfekripreemlqmqdivlnevkkldpeyiatvcgs
    frrgaessgdmdvllthpnftsesskqpkllhrvveqlqkvrfitdtlskgetkfmgvcq
    lpsendeneyphrridirlipkdqyycgvlyftgsdifnknmrahalekgftineytirp
    lgvtgvageplpvdseqdifdyiqwryrepkdrse
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uxnB (B:)
    tlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtki
    aekideflatgklrklekirqddtsssinfltrvtgigpsaarklvdegiktledlrkne
    dklnhhqriglkyfedfekripreemlqmqdivlnevkkldpeyiatvcgsfrrgaessg
    dmdvllthpnftsesskqpkllhrvveqlqkvrfitdtlskgetkfmgvcqlpsendene
    yphrridirlipkdqyycgvlyftgsdifnknmrahalekgftineytirplgvtgvage
    plpvdseqdifdyiqwryrepkdrs