PDB entry 3ux9

View 3ux9 on RCSB PDB site
Description: Structural insights into a human anti-IFN antibody exerting therapeutic potential for systemic lupus erythematosus
Class: cytokine/immune system
Keywords: five helices, long loop connecting helix, hydrophobic interactions, CYTOKINE-IMMUNE SYSTEM complex
Deposited on 2011-12-04, released 2012-02-29
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-02-29, with a file datestamp of 2012-02-24.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.186
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interferon alpha-1/13
    Species: Homo sapiens [TaxId:9606]
    Gene: IFNA1, IFNA13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3ux9a_
  • Chain 'B':
    Compound: ScFv antibody
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3UX9
  • Chain 'C':
    Compound: Interferon alpha-1/13
    Species: Homo sapiens [TaxId:9606]
    Gene: IFNA1, IFNA13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3ux9c_
  • Chain 'D':
    Compound: ScFv antibody
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3UX9
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ux9A (A:)
    snacdlpethsldnrrtlmllaqmsrispssclmdrhdfgfpqeefdgnqfqkapaisvl
    heliqqifnlfttkdssaawdedlldkfctelyqqlndleacvmqeervgetplmnadsi
    lavkkyfrritlyltekkyspcawevvraeimrslslstnlqerlrrke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ux9A (A:)
    ldnrrtlmllaqmsrispssclmdrhdfgfpqeefdapaisvlheliqqifnlfttkdss
    aawdedlldkfctelyqqlndleacvmqnadsilavkkyfrritlyltekkyspcawevv
    raeimrslslst
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ux9C (C:)
    snacdlpethsldnrrtlmllaqmsrispssclmdrhdfgfpqeefdgnqfqkapaisvl
    heliqqifnlfttkdssaawdedlldkfctelyqqlndleacvmqeervgetplmnadsi
    lavkkyfrritlyltekkyspcawevvraeimrslslstnlqerlrrke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ux9C (C:)
    ldnrrtlmllaqmsrispssclmdrhdfgfpqeefpaisvlheliqqifnlfttkdssaa
    wdedlldkfctelyqqlndleacvmnadsilavkkyfrritlyltekkyspcawevvrae
    imrslslst
    

  • Chain 'D':
    No sequence available.