PDB entry 3uwq

View 3uwq on RCSB PDB site
Description: 1.80 Angstrom resolution crystal structure of orotidine 5'-phosphate decarboxylase from Vibrio cholerae O1 biovar eltor str. N16961 in complex with uridine-5'-monophosphate (UMP)
Class: lyase
Keywords: Orotidine 5'-Phosphate Decarboxylase, Structural Genomics, Center for Structural Genomics of Infectious Diseases, Decarboxylase, Lyase, Pyrimidine biosynthesis, CSGID, uridine-5'-monophosphate, TIM-barrel
Deposited on 2011-12-02, released 2011-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Vibrio cholerae [TaxId:666]
    Gene: pyrF, VC_1911
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3uwqa_
  • Chain 'B':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Vibrio cholerae [TaxId:666]
    Gene: pyrF, VC_1911
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3uwqb_
  • Heterogens: U5P, XPE, PEG, PGE, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3uwqA (A:)
    mhhhhhhssgvdlgtenlyfqsnamndpkvivaldydnladalafvdkidpstcrlkvgk
    emftlfgpdfvrelhkrgfsvfldlkfhdipntcskavkaaaelgvwmvnvhasggermm
    aasreilepygkerplligvtvltsmesadlqgigilsapqdhvlrlatltknagldgvv
    csaqeasllkqhlgrefklvtpgirpagseqgdqrrimtpaqaiasgsdylvigrpitqa
    ahpevvleeinsslv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uwqA (A:)
    ndpkvivaldydnladalafvdkidpstcrlkvgkemftlfgpdfvrelhkrgfsvfldl
    kfhdipntcskavkaaaelgvwmvnvhasggermmaasreilepygkerplligvtvlts
    mesadlqgigilsapqdhvlrlatltknagldgvvcsaqeasllkqhlgrefklvtpgir
    parrimtpaqaiasgsdylvigrpitqaahpevvleeinssl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3uwqB (B:)
    mhhhhhhssgvdlgtenlyfqsnamndpkvivaldydnladalafvdkidpstcrlkvgk
    emftlfgpdfvrelhkrgfsvfldlkfhdipntcskavkaaaelgvwmvnvhasggermm
    aasreilepygkerplligvtvltsmesadlqgigilsapqdhvlrlatltknagldgvv
    csaqeasllkqhlgrefklvtpgirpagseqgdqrrimtpaqaiasgsdylvigrpitqa
    ahpevvleeinsslv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uwqB (B:)
    dpkvivaldydnladalafvdkidpstcrlkvgkemftlfgpdfvrelhkrgfsvfldlk
    fhdipntcskavkaaaelgvwmvnvhasggermmaasreilepygkerplligvtvltsm
    esadlqgigilsapqdhvlrlatltknagldgvvcsaqeasllkqhlgrefklvtpgirp
    agsqrrimtpaqaiasgsdylvigrpitqaahpevvleeinssl