PDB entry 3uwd

View 3uwd on RCSB PDB site
Description: Crystal Structure of Phosphoglycerate Kinase from Bacillus Anthracis
Class: transferase
Keywords: Anthrax, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, Rossmann fold, phosphoglycerate kinase, phosphoglycerate, Phosphorylation, TRANSFERASE
Deposited on 2011-12-01, released 2012-01-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-05-23, with a file datestamp of 2012-05-18.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: 0.176
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoglycerate kinase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BAS4988, BA_5367, GBAA_5367, pgk
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81X75 (0-393)
      • engineered mutation (189)
    Domains in SCOPe 2.08: d3uwda_
  • Heterogens: CL, MG, BTB, UNL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3uwdA (A:)
    mnkksirdvdlkgkrvfcrvdfnvpmkegkitdetriraalptiqylveqgakvilashl
    grpkgqaveelrltpvaarlgellgkdvkkadeafgpvaqemvaamnegdvlvlenvrfy
    ageekndaelakefaaladifvndafgaahrahastagiadylpavsgllmekelevlgk
    alsnperpfaaiiggakvkdkiglirhlldkvdnliiggglaytfvkalgheiglslced
    dkielakefmqlakekgvnfympvdvviteefsetattkivgidsipsnwegvdigpktr
    eiyadviknsklvvwngpmgvfemtpfaegtkavgqaladaegtysvigggdsaaavekf
    gmadkmshistgggaslefmegkelpgvvclndk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uwdA (A:)
    mnkksirdvdlkgkrvfcrvdfnvpmgkitdetriraalptiqylveqgakvilashlgr
    pkgqaveelrltpvaarlgellgkdvkkadeafgpvaqemvaamnegdvlvlenvrfyag
    eekndaelakefaaladifvndafgaahrahastagiadylpavsgllmekelevlgkal
    snperpfaaiiggakvkdkiglirhlldkvdnliiggglaytfvkalgheiglslceddk
    ielakefmqlakekgvnfympvdvviteefsetattkivgidsipsnwegvdigpktrei
    yadviknsklvvwngpmgvfemtpfaegtkavgqaladaegtysvigggdsaaavekfgm
    adkmshistgggaslefmegkelpgvvclndk