PDB entry 3uwc

View 3uwc on RCSB PDB site
Description: Structure of an aminotransferase (DegT-DnrJ-EryC1-StrS family) from Coxiella burnetii in complex with PMP
Class: transferase
Keywords: lipopolysaccharide biosynthesis, transferase
Deposited on 2011-12-01, released 2011-12-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-12-14, with a file datestamp of 2011-12-09.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.168
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleotide-sugar aminotransferase
    Species: Coxiella burnetii [TaxId:777]
    Gene: CBU_0696
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3uwca_
  • Heterogens: DIO, NA, EDO, PMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3uwcA (A:)
    snamrvpysylerqfadiepylndlrefiktadftlgaelekfekrfaalhnaphaigvg
    tgtdalamsfkmlnigagdevitcantfiasvgaivqagatpvlvdsengyvidpekiea
    aitdktkaimpvhytgniadmpalakiakkhnlhivedacqtilgrindkfvgswgqfac
    fslhplknlnvwsdagviithsdeyaeklrlyrnhglinrdvcveygincrmdtiqavia
    nrlmnqletitekrrgiahlydqsfvdlsefidvpvrregvyhvfhiyvlrvkyrdqlfq
    ylkdngievkihypiamhlqpaakslgyqqgdfpmaekhgeavitlpahpylteeeinyi
    ikkvrefylekhyn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uwcA (A:)
    mrvpysylerqfadiepylndlrefiktadftlgaelekfekrfaalhnaphaigvgtgt
    dalamsfkmlnigagdevitcantfiasvgaivqagatpvlvdsengyvidpekieaait
    dktkaimpvhytgniadmpalakiakkhnlhivedacqtilgrindkfvgswgqfacfsl
    hplknlnvwsdagviithsdeyaeklrlyrnhglinrdvcveygincrmdtiqavianrl
    mnqletitekrrgiahlydqsfvdlsefidvpvrregvyhvfhiyvlrvkyrdqlfqylk
    dngievkihypiamhlqpaakslgyqqgdfpmaekhgeavitlpahpylteeeinyiikk
    vrefylekhyn