PDB entry 3uvr

View 3uvr on RCSB PDB site
Description: Human p38 MAP Kinase in Complex with KM064
Class: transferase/transferase inhibitor
Keywords: protein kinase, selective p38 inhibitor, SAR, annulen derivative, pyrazolo urea, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2011-11-30, released 2012-12-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-12-19, with a file datestamp of 2012-12-14.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.206
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3uvra_
  • Heterogens: 06F, BOG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3uvrA (A:)
    gsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfq
    siihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcq
    kltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemt
    gyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvg
    tpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaa
    qalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uvrA (A:)
    rptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsiih
    akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltd
    dhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglatrwyrapeimln
    wmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesar
    nyiqslkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddepva
    dpydqsfesrdllidewksltydevisfvpp