PDB entry 3uvh

View 3uvh on RCSB PDB site
Description: Crystal Structure Analysis of E81M mutant of human CLIC1
Class: transport protein
Keywords: CLIC, Glutathione Transferase, thioredoxin salt bridge ion channel, GST thioredoxin fold, Ion channel, cytoplasm nuclear membrane, TRANSPORT PROTEIN
Deposited on 2011-11-30, released 2011-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-14, with a file datestamp of 2011-12-09.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.204
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chloride intracellular channel protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CLIC1, G6, NCC27
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00299 (Start-240)
      • engineered mutation (80)
    Domains in SCOPe 2.07: d3uvha1, d3uvha2
  • Chain 'B':
    Compound: chloride intracellular channel protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CLIC1, G6, NCC27
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00299
      • engineered mutation (80)
    Domains in SCOPe 2.07: d3uvhb1, d3uvhb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3uvhA (A:)
    maeeqpqvelfvkagsdgakigncpfsqrlfmvlwlkgvtfnvttvdtkrrtetvqklcp
    ggqlpfllygtevhtdtnkimefleavlcpprypklaalnpesntagldifakfsayikn
    snpalndnlekgllkalkvldnyltsplpeevdetsaedegvsqrkfldgneltladcnl
    lpklhivqvvckkyrgftipeafrgvhrylsnayareefastcpddeeielayeqvakal
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uvhA (A:)
    eqpqvelfvkagsdgakigncpfsqrlfmvlwlkgvtfnvttvdtkrrtetvqklcpggq
    lpfllygtevhtdtnkimefleavlcpprypklaalnpesntagldifakfsayiknsnp
    alndnlekgllkalkvldnyltsplpeevegvsqrkfldgneltladcnllpklhivqvv
    ckkyrgftipeafrgvhrylsnayareefastcpddeeielayeqvakalk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3uvhB (B:)
    maeeqpqvelfvkagsdgakigncpfsqrlfmvlwlkgvtfnvttvdtkrrtetvqklcp
    ggqlpfllygtevhtdtnkimefleavlcpprypklaalnpesntagldifakfsayikn
    snpalndnlekgllkalkvldnyltsplpeevdetsaedegvsqrkfldgneltladcnl
    lpklhivqvvckkyrgftipeafrgvhrylsnayareefastcpddeeielayeqvakal
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uvhB (B:)
    pqvelfvkagsdgakigncpfsqrlfmvlwlkgvtfnvttvdtkrrtetvqklcpggqlp
    fllygtevhtdtnkimefleavlcpprypklaalnpesntagldifakfsayiknsnpal
    ndnlekgllkalkvldnyltsplpeevdetsaedegvsqrkfldgneltladcnllpklh
    ivqvvckkyrgftipeafrgvhrylsnayareefastcpddeeielayeqva