PDB entry 3uv9

View 3uv9 on RCSB PDB site
Description: Structure of the rhesus monkey TRIM5alpha deltav1 PRYSPRY domain
Class: ligase
Keywords: domain swap, antiretroviral, HIV Capsid, LIGASE
Deposited on 2011-11-29, released 2012-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-16, with a file datestamp of 2017-08-11.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tripartite motif-containing protein 5
    Species: Macaca mulatta [TaxId:9544]
    Gene: TRIM5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0PF16 (2-35)
      • expression tag (1)
      • variant (17)
      • see remark 999 (36-37)
    • Uniprot Q0PF16 (38-End)
    Domains in SCOPe 2.07: d3uv9a1, d3uv9a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3uv9A (A:)
    gteltdarrywvdvtlatnnishaviaedkrqvssragtgvlgsqsitsgkhywevdvsk
    ksawilgvcagfqsdamynieqnenyqpkygywviglqegvkysvfqdgsshtpfapfiv
    plsviicpdrvgvfvdyeactvsffnitnhgfliykfsqcsfskpvfpylnprkctvpmt
    lcspss
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uv9A (A:)
    teltdarrywvdvtlatnnishaviaedkrqvssragtgvlgsqsitsgkhywevdvskk
    sawilgvcagfqsdamynieqnenyqpkygywviglqegvkysvfqdgsshtpfapfivp
    lsviicpdrvgvfvdyeactvsffnitnhgfliykfsqcsfskpvfpylnprkctvpmtl
    csp