PDB entry 3uv4

View 3uv4 on RCSB PDB site
Description: Crystal Structure of the second bromodomain of human Transcription initiation factor TFIID subunit 1 (TAF1)
Class: transcription
Keywords: Structural Genomics Consortium, SGC, TRANSCRIPTION
Deposited on 2011-11-29, released 2012-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-11, with a file datestamp of 2012-04-06.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.192
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: second bromodomain of human Transcription initiation factor TFIID subunit 1 (TAF1)
    Species: Homo sapiens [TaxId:9606]
    Gene: BA2R, CCG1, CCGS, TAF1, TAF2A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21675 (23-End)
      • expression tag (21-22)
    Domains in SCOPe 2.07: d3uv4a1, d3uv4a2
  • Chain 'B':
    Compound: second bromodomain of human Transcription initiation factor TFIID subunit 1 (TAF1)
    Species: Homo sapiens [TaxId:9606]
    Gene: BA2R, CCG1, CCGS, TAF1, TAF2A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21675 (23-End)
      • expression tag (21-22)
    Domains in SCOPe 2.07: d3uv4b1, d3uv4b2
  • Heterogens: EDO, GOL, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3uv4A (A:)
    mhhhhhhssgvdlgtenlyfqsmdddqvafsfildnivtqkmmavpdswpfhhpvnkkfv
    pdyykvivnpmdletirkniskhkyqsresflddvnlilansvkyngpesqytktaqeiv
    nvcyqtlteydehltqlekdictakeaaleeaelesld
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uv4A (A:)
    smdddqvafsfildnivtqkmmavpdswpfhhpvnkkfvpdyykvivnpmdletirknis
    khkyqsresflddvnlilansvkyngpesqytktaqeivnvcyqtlteydehltqlekdi
    ctake
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3uv4B (B:)
    mhhhhhhssgvdlgtenlyfqsmdddqvafsfildnivtqkmmavpdswpfhhpvnkkfv
    pdyykvivnpmdletirkniskhkyqsresflddvnlilansvkyngpesqytktaqeiv
    nvcyqtlteydehltqlekdictakeaaleeaelesld
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uv4B (B:)
    smdddqvafsfildnivtqkmmavpdswpfhhpvnkkfvpdyykvivnpmdletirknis
    khkyqsresflddvnlilansvkyngpesqytktaqeivnvcyqtlteydehltqlekdi
    ctakea