PDB entry 3uv2

View 3uv2 on RCSB PDB site
Description: Crystal structure of the bromodomain of human nucleosome-remodeling factor subunit BPTF
Class: transcription
Keywords: Bromodomain, BPTF, FALZ, FAC1, Bromodomain and PHD finger-containing transcription factor, Fetal Alz-50 clone 1 protein, Fetal Alzheimer antigen, Structural Genomics Consortium, SGC, TRANSCRIPTION
Deposited on 2011-11-29, released 2012-01-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: bromodomain of human nucleosome-remodeling factor subunit BPTF
  Species: Homo sapiens [TaxId:9606]
  Gene: BPTF, FAC1, FALZ
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q12830 (Start-125)
  Domains in SCOPe 2.08: d3uv2a_
• Heterogens: 7PE, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3uv2A (A:)
  smqcqstedamtvltpltekdyeglkrvlrslqahkmawpflepvdpndapdyygvikep
  mdlatmeervqrryyekltefvadmtkifdncryynpsdspfyqcaevlesffvqklkgf
  kasrsh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3uv2A (A:)
  edamtvltpltekdyeglkrvlrslqahkmawpflepvdpndapdyygvikepmdlatme
  ervqrryyekltefvadmtkifdncryynpsdspfyqcaevlesffvqklkgfkasrsh