PDB entry 3utz

View 3utz on RCSB PDB site
Description: Endogenous-like inhibitory antibodies targeting activated metalloproteinase motifs show therapeutic potential
Class: immune system
Keywords: Structural Genomics, Israel Structural Proteomics Center, ISPC, Fab domain, IMMUNE SYSTEM
Deposited on 2011-11-27, released 2011-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-15, with a file datestamp of 2017-03-10.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metalloproteinase, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3UTZ
    Domains in SCOPe 2.07: d3utza1, d3utza2
  • Chain 'B':
    Compound: Metalloproteinase, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3UTZ (0-End)
  • Chain 'C':
    Compound: Metalloproteinase, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3UTZ (0-End)
  • Chain 'D':
    Compound: Metalloproteinase, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3UTZ
    Domains in SCOPe 2.07: d3utzd1, d3utzd2
  • Chain 'E':
    Compound: Metalloproteinase, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3UTZ
    Domains in SCOPe 2.07: d3utze1, d3utze2
  • Chain 'F':
    Compound: Metalloproteinase, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3UTZ (0-End)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3utzA (A:)
    dvlmtqtplslpvslgdqasiscrssqsivhsngntflewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqashvpptfgsgtkleikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3utzA (A:)
    vlmtqtplslpvslgdqasiscrssqsivhsngntflewylqkpgqspklliykvsnrfs
    gvpdrfsgsgsgtdftlkisrveaedlgvyycfqashvpptfgsgtkleikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3utzD (D:)
    dvlmtqtplslpvslgdqasiscrssqsivhsngntflewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqashvpptfgsgtkleikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3utzD (D:)
    vlmtqtplslpvslgdqasiscrssqsingntflewylqkpgqspklliykvsnrfsgvp
    drfsgsgsgtdftlkisrveaedlgvyycfqashvpptfgsgtkleikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3utzE (E:)
    dvlmtqtplslpvslgdqasiscrssqsivhsngntflewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqashvpptfgsgtkleikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3utzE (E:)
    vlmtqtplslpvslgdqasiscrssqsivhgntflewylqkpgqspklliykvsnrfsgv
    pdrfsgsggtdftlkisrveaedlgvyycfqashvpptfgsgtkleikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'F':
    No sequence available.