PDB entry 3utp

View 3utp on RCSB PDB site
Description: 1E6 TCR specific for HLA-A*0201-ALWGPDPAAA
Class: immune system
Keywords: T cell receptor, Type I Diabetes, IMMUNE SYSTEM
Deposited on 2011-11-26, released 2012-01-25
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-03-07, with a file datestamp of 2012-03-02.
Experiment type: XRAY
Resolution: 2.57 Å
R-factor: 0.233
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: 1E6 TCR Alpha Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3UTP (0-End)
    Domains in SCOPe 2.04: d3utpd1, d3utpd2
  • Chain 'E':
    Compound: 1E6 TCR Beta Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3UTP (0-245)
    Domains in SCOPe 2.04: d3utpe1, d3utpe2
  • Chain 'K':
    Compound: 1E6 TCR Alpha Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3UTP (0-200)
    Domains in SCOPe 2.04: d3utpk1, d3utpk2
  • Chain 'L':
    Compound: 1E6 TCR Beta Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3UTP (0-245)
    Domains in SCOPe 2.04: d3utpl1, d3utpl2
  • Heterogens: GOL, SO4, BTB, HOH

PDB Chain Sequences:

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3utpD (D:)
    keveqdpgplsvpegaivslnctysnsafqyfmwyrqysrkgpellmytyssgnkedgrf
    taqvdksskyislfirdsqpsdsatylcamrgdssyklifgsgtrllvrpdiqnpdpavy
    qlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksd
    facanafnnsiipedtffpsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3utpD (D:)
    keveqdpgplsvpegaivslnctysnsafqyfmwyrqysrkgpellmytyssgnkedgrf
    taqvdksskyislfirdsqpsdsatylcamrgdssyklifgsgtrllvrpdiqnpdpavy
    qlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksd
    facanafnnsiipedtffp
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3utpE (E:)
    dagviqsprhevtemgqqvtlrckpisghdylfwyrqtmmrglelliyfnnnvpiddsgm
    pedrfsakmpnasfstlkiqpseprdsavyfcasslweklakniqyfgagtrlsvledlk
    nvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplk
    eqpalndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqivsae
    awgrad
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3utpK (K:)
    keveqdpgplsvpegaivslnctysnsafqyfmwyrqysrkgpellmytyssgnkedgrf
    taqvdksskyislfirdsqpsdsatylcamrgdssyklifgsgtrllvrpdiqnpdpavy
    qlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksd
    facanafnnsiipedtffpsp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3utpL (L:)
    dagviqsprhevtemgqqvtlrckpisghdylfwyrqtmmrglelliyfnnnvpiddsgm
    pedrfsakmpnasfstlkiqpseprdsavyfcasslweklakniqyfgagtrlsvledlk
    nvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplk
    eqpalndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqivsae
    awgrad