PDB entry 3us6

View 3us6 on RCSB PDB site
Description: Crystal Structure of Histidine-containing Phosphotransfer Protein MtHPt1 from Medicago truncatula
Class: transferase
Keywords: helix bundle, PLANT HORMONE SIGNAL TRANSDUCTION, CYTOKININ SIGNAL TRANSDUCTION, PHOSPHORYLATION, PHOSPHATE TRANSFER RELAY, RESPONSE REGULATOR, TRANSFERASE, SIGNALING PROTEIN, CYTOKININ RECEPTOR CRE1
Deposited on 2011-11-23, released 2012-01-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histidine-containing Phosphotransfer Protein type 1, MtHPt1
    Species: Medicago truncatula [TaxId:3880]
    Gene: MtHPt
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3us6a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3us6A (A:)
    mevgqmrrqwvdyiksmfmegfldgqflqlqqlqdennpefvfevvslffddserilkdl
    sfavdqqsidfkkvdahvhqfkgssasigaqrvknscvafrnfceeqnidacrrclqqvk
    qeyllvknkletllrleqqivaaggsipmmeln
    

    Sequence, based on observed residues (ATOM records): (download)
    >3us6A (A:)
    evgqmrrqwvdyiksmfmegfldgqflqlqqlqdennpefvfevvslffddserilkdls
    favdqqsidfkkvdahvhqfkgssasigaqrvknscvafrnfceeqnidacrrclqqvkq
    eyllvknkletllrleqqivaaggsipm