PDB entry 3url

View 3url on RCSB PDB site
Description: Endothiapepsin-DB6 complex.
Class: hydrolase/hydrolase inhibitor
Keywords: hydrolase-hydrolase inhibitor complex, aspartic proteinase mechanism, transition state analogue.
Deposited on 2011-11-22, released 2012-04-18
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-05-09, with a file datestamp of 2012-05-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.147
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endothiapepsin
    Species: Endothia parasitica [TaxId:5116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11838 (0-329)
      • see remark 999 (53)
    Domains in SCOPe 2.05: d3urla_
  • Chain 'B':
    Compound: DB6 peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 3URL (0-7)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3urlA (A:)
stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
ginifgdvalkaafvvfngattptlgfask

  • Chain 'B':
    No sequence available.