PDB entry 3urf

View 3urf on RCSB PDB site
Description: Human RANKL/OPG complex
Class: cytokine
Keywords: cystein-rich domain, beta-sandwich, CYTOKINE
Deposited on 2011-11-22, released 2012-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-07-11, with a file datestamp of 2012-07-06.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.205
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor necrosis factor ligand superfamily member 11, soluble form
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFSF11, OPGL, RANKL, TRANCE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3urfa_
  • Chain 'Z':
    Compound: Tumor necrosis factor receptor superfamily member 11B
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFRSF11B, OCIF, OPG
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00300 (Start-164)
      • expression tag (165-167)
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3urfA (A:)
    aqpfahltinatdipsgshkvslsswyhdrgwakisnmtfsngklivnqdgfyylyanic
    frhhetsgdlateylqlmvyvtktsikipsshtlmkggstkywsgnsefhfysinvggff
    klrsgeeisievsnpslldpdqdatyfgafkvrdidhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3urfA (A:)
    aqpfahltinatdipsgshkvslsswyhdrgwakisnmtfsngklivnqdgfyylyanic
    frhhetsgdlateylqlmvyvtktsikipsshtlmkggstkywsgnsefhfysinvggff
    klrsgeeisievsnpslldpdqdatyfgafkvrdid
    

  • Chain 'Z':
    No sequence available.