PDB entry 3urc

View 3urc on RCSB PDB site
Description: T181G mutant of alpha-Lytic Protease
Class: hydrolase
Keywords: Serine protease, hydrolase
Deposited on 2011-11-22, released 2012-05-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-07-18, with a file datestamp of 2012-07-13.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.117
AEROSPACI score: 0.95 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-lytic protease
    Species: Lysobacter enzymogenes [TaxId:69]
    Gene: ALPHA-LP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00778 (Start-197)
      • engineered mutation (131)
    Domains in SCOPe 2.05: d3urca_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3urcA (A:)
anivggieysinnaslcsvgfsvtrgatkgfvtaghcgtvnatariggavvgtfaarvfp
gndrawvsltsaqtllprvangssfvtvrgsteaavgaavcrsgrttgyqcgtitaknvt
anyaegavrglgqgnacmgrgdsggswitsagqaqgvmsggnvqsngnncgipasqrssl
ferlqpilsqyglslvtg