PDB entry 3uqy

View 3uqy on RCSB PDB site
Description: H2-reduced structure of E. coli hydrogenase-1
Class: oxidoreductase
Keywords: membrane-bound hydrogenase, oxidoreductase
Deposited on 2011-11-21, released 2012-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-18, with a file datestamp of 2012-04-13.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: 0.124
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'L':
    Compound: Hydrogenase-1 large chain
    Species: Escherichia coli [TaxId:562]
    Gene: b0973, hyaB, JW0955
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3uqyl_
  • Chain 'M':
    Compound: Hydrogenase-1 large chain
    Species: Escherichia coli [TaxId:562]
    Gene: b0973, hyaB, JW0955
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3uqym_
  • Chain 'S':
    Compound: Hydrogenase-1 small chain
    Species: Escherichia coli [TaxId:562]
    Gene: b0972, hyaA, JW0954
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3uqys_
  • Chain 'T':
    Compound: Hydrogenase-1 small chain
    Species: Escherichia coli [TaxId:562]
    Gene: b0972, hyaA, JW0954
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3uqyt_
  • Heterogens: SF4, F3S, F4S, LMT, CL, SO4, FCO, NI, MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3uqyL (L:)
    mstqyetqgytinnagrrlvvdpitrieghmrcevnindqnvitnavscgtmfrgleiil
    qgrdprdawafvericgvctgvhalasvyaiedaigikvpdnaniirnimlatlwchdhl
    vhfyqlagmdwidvldalkadprktselaqslsswpksspgyffdvqnrlkkfveggqlg
    ifrngywghpqyklppeanlmgfahylealdfqreivkihavfggknphpnwivggmpca
    inidesgavgavnmerlnlvqsiitrtadfinnvmipdalaigqfnkpwseigtglsdkc
    vlsygafpdiandfgeksllmpggavingdfnnvlpvdlvdpqqvqefvdhawyrypndq
    vgrhpfdgitdpwynpgdvkgsdtniqqlneqeryswikaprwrgnamevgplartliay
    hkgdaatvesvdrmmsalnlplsgiqstlgrilcraheaqwaagklqyffdklmtnlkng
    nlatastekwepatwptecrgvgfteaprgalghwaairdgkidlyqcvvpttwnasprd
    pkgqigayeaalmntkmaipeqpleilrtlhsfdpclacsth
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uqyL (L:)
    stqyetqgytinnagrrlvvdpitrieghmrcevnindqnvitnavscgtmfrgleiilq
    grdprdawafvericgvctgvhalasvyaiedaigikvpdnaniirnimlatlwchdhlv
    hfyqlagmdwidvldalkadprktselaqslsswpksspgyffdvqnrlkkfveggqlgi
    frngywghpqyklppeanlmgfahylealdfqreivkihavfggknphpnwivggmpcai
    nidesgavgavnmerlnlvqsiitrtadfinnvmipdalaigqfnkpwseigtglsdkcv
    lsygafpdiandfgeksllmpggavingdfnnvlpvdlvdpqqvqefvdhawyrypndqv
    grhpfdgitdpwynpgdvkgsdtniqqlneqeryswikaprwrgnamevgplartliayh
    kgdaatvesvdrmmsalnlplsgiqstlgrilcraheaqwaagklqyffdklmtnlkngn
    latastekwepatwptecrgvgfteaprgalghwaairdgkidlyqcvvpttwnasprdp
    kgqigayeaalmntkmaipeqpleilrtlhsfdpclacsth
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3uqyM (M:)
    mstqyetqgytinnagrrlvvdpitrieghmrcevnindqnvitnavscgtmfrgleiil
    qgrdprdawafvericgvctgvhalasvyaiedaigikvpdnaniirnimlatlwchdhl
    vhfyqlagmdwidvldalkadprktselaqslsswpksspgyffdvqnrlkkfveggqlg
    ifrngywghpqyklppeanlmgfahylealdfqreivkihavfggknphpnwivggmpca
    inidesgavgavnmerlnlvqsiitrtadfinnvmipdalaigqfnkpwseigtglsdkc
    vlsygafpdiandfgeksllmpggavingdfnnvlpvdlvdpqqvqefvdhawyrypndq
    vgrhpfdgitdpwynpgdvkgsdtniqqlneqeryswikaprwrgnamevgplartliay
    hkgdaatvesvdrmmsalnlplsgiqstlgrilcraheaqwaagklqyffdklmtnlkng
    nlatastekwepatwptecrgvgfteaprgalghwaairdgkidlyqcvvpttwnasprd
    pkgqigayeaalmntkmaipeqpleilrtlhsfdpclacsth
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uqyM (M:)
    stqyetqgytinnagrrlvvdpitrieghmrcevnindqnvitnavscgtmfrgleiilq
    grdprdawafvericgvctgvhalasvyaiedaigikvpdnaniirnimlatlwchdhlv
    hfyqlagmdwidvldalkadprktselaqslsswpksspgyffdvqnrlkkfveggqlgi
    frngywghpqyklppeanlmgfahylealdfqreivkihavfggknphpnwivggmpcai
    nidesgavgavnmerlnlvqsiitrtadfinnvmipdalaigqfnkpwseigtglsdkcv
    lsygafpdiandfgeksllmpggavingdfnnvlpvdlvdpqqvqefvdhawyrypndqv
    grhpfdgitdpwynpgdvkgsdtniqqlneqeryswikaprwrgnamevgplartliayh
    kgdaatvesvdrmmsalnlplsgiqstlgrilcraheaqwaagklqyffdklmtnlkngn
    latastekwepatwptecrgvgfteaprgalghwaairdgkidlyqcvvpttwnasprdp
    kgqigayeaalmntkmaipeqpleilrtlhsfdpclacsth
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3uqyS (S:)
    lenkpripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevf
    ediitqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgc
    vqaarpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplm
    fygqrihdkcyrrahfdagefvqswdddaarkgyclykmgckgpttynacsstrwndgvs
    fpiqsghgclgcaengfwdrgsfysrvvdipqmgthstadtvgltalgvvaaavgvhava
    savdqrrrhnqqptetehqpgnedkqarshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uqyS (S:)
    kpripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevfedi
    itqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgcvqa
    arpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplmfyg
    qrihdkcyrrahfdagefvqswdddaarkgyclykmgckgpttynacsstrwndgvsfpi
    qsghgclgcaengfwdrgsfysrvv
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3uqyT (T:)
    lenkpripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevf
    ediitqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgc
    vqaarpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplm
    fygqrihdkcyrrahfdagefvqswdddaarkgyclykmgckgpttynacsstrwndgvs
    fpiqsghgclgcaengfwdrgsfysrvvdipqmgthstadtvgltalgvvaaavgvhava
    savdqrrrhnqqptetehqpgnedkqarshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uqyT (T:)
    kpripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevfedi
    itqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgcvqa
    arpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplmfyg
    qrihdkcyrrahfdagefvqswdddaarkgyclykmgckgpttynacsstrwndgvsfpi
    qsghgclgcaengfwdrgsfysrvv