PDB entry 3uqv

View 3uqv on RCSB PDB site
Description: Bovine trypsin variant X(triplePhe227) in complex with small molecule inhibitor
Class: HYDROLASE/HYDROLASE inhibitor
Keywords: Trypsin-like serine protease, HYDROLASE, PROTEIN BINDING, DUODENUM, HYDROLASE-HYDROLASE inhibitor complex
Deposited on 2011-11-21, released 2012-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-07-16, with a file datestamp of 2014-07-11.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.169
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00760 (0-222)
      • engineered mutation (78)
      • engineered mutation (80)
      • engineered mutation (151-154)
      • engineered mutation (204)
    Domains in SCOPe 2.07: d3uqva_
  • Heterogens: CA, 3YH, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3uqvA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsetynndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksassfiitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgfytkvcnyvswikqtiasn