PDB entry 3upa
View 3upa on RCSB PDB site
Description: A general strategy for the generation of human antibody variable domains with increased aggregation resistance
Class: immune system
Keywords: immunoglobulin fold, IMMUNE SYSTEM
Deposited on
2011-11-17, released
2012-06-20
The last revision prior to the SCOPe 2.08 freeze date was dated
2017-11-08, with a file datestamp of
2017-11-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: kappa light chain variable domain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3upaa_ - Chain 'B':
Compound: kappa light chain variable domain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3upab_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3upaA (A:)
diqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliydaddlqsgvps
rfsgsgsgtdftltisslqpedfatyycqqsystpntfgqgtkveik
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3upaB (B:)
diqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliydaddlqsgvps
rfsgsgsgtdftltisslqpedfatyycqqsystpntfgqgtkveik