PDB entry 3upa

View 3upa on RCSB PDB site
Description: A general strategy for the generation of human antibody variable domains with increased aggregation resistance
Class: immune system
Keywords: immunoglobulin fold, IMMUNE SYSTEM
Deposited on 2011-11-17, released 2012-06-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: kappa light chain variable domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3UPA (0-106)
    Domains in SCOPe 2.08: d3upaa_
  • Chain 'B':
    Compound: kappa light chain variable domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3UPA (0-106)
    Domains in SCOPe 2.08: d3upab_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3upaA (A:)
    diqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliydaddlqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqsystpntfgqgtkveik
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3upaB (B:)
    diqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliydaddlqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqsystpntfgqgtkveik