PDB entry 3uoi

View 3uoi on RCSB PDB site
Description: Mycobacterium tuberculosis bacterioferritin, BfrA
Class: oxidoreductase
Keywords: Structural Genomics, TB Structural Genomics Consortium, TBSGC, ferroxidation and iron storage, cytosol, OXIDOREDUCTASE
Deposited on 2011-11-16, released 2012-12-05
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-12-05, with a file datestamp of 2012-11-30.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.151
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3uoia_
  • Chain 'B':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3uoib_
  • Chain 'C':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3uoic_
  • Chain 'D':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3uoid_
  • Chain 'E':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3uoie_
  • Chain 'F':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3uoif_
  • Chain 'G':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3uoig_
  • Chain 'H':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3uoih_
  • Chain 'I':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3uoii_
  • Chain 'J':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3uoij_
  • Chain 'K':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3uoik_
  • Chain 'L':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3uoil_
  • Chain 'M':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3uoim_
  • Chain 'N':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3uoin_
  • Chain 'O':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3uoio_
  • Chain 'P':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3uoip_
  • Chain 'Q':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3uoiq_
  • Chain 'R':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3uoir_
  • Chain 'S':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3uois_
  • Chain 'T':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3uoit_
  • Chain 'U':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3uoiu_
  • Chain 'V':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed):
  • Chain 'W':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3uoix_
  • Chain 'a':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed):
  • Chain 'b':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed):
  • Chain 'c':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed):
  • Chain 'd':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed):
  • Chain 'e':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed):
  • Chain 'f':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed):
  • Chain 'g':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed):
  • Chain 'h':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed):
  • Chain 'i':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed):
  • Chain 'j':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed):
  • Chain 'k':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed):
  • Chain 'l':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed):
  • Chain 'm':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed):
  • Chain 'n':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed):
  • Chain 'o':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed):
  • Chain 'p':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed):
  • Chain 'q':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed):
  • Chain 'r':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed):
  • Chain 's':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed):
  • Chain 't':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed):
  • Chain 'u':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed):
  • Chain 'v':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3uoiv_
  • Chain 'w':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3uoiw_
  • Chain 'x':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3uoiA (A:)
    mgmqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeei
    tdrillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsav
    llekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uoiA (A:)
    mqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitd
    rillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavll
    ekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3uoiB (B:)
    mgmqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeei
    tdrillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsav
    llekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uoiB (B:)
    mqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitd
    rillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavll
    ekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3uoiC (C:)
    mgmqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeei
    tdrillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsav
    llekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uoiC (C:)
    mqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitd
    rillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavll
    ekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3uoiD (D:)
    mgmqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeei
    tdrillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsav
    llekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uoiD (D:)
    mqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitd
    rillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavll
    ekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3uoiE (E:)
    mgmqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeei
    tdrillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsav
    llekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uoiE (E:)
    mqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitd
    rillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavll
    ekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3uoiF (F:)
    mgmqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeei
    tdrillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsav
    llekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uoiF (F:)
    mqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitd
    rillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavll
    ekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3uoiG (G:)
    mgmqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeei
    tdrillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsav
    llekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uoiG (G:)
    mqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitd
    rillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavll
    ekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3uoiH (H:)
    mgmqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeei
    tdrillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsav
    llekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uoiH (H:)
    mqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitd
    rillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavll
    ekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3uoiI (I:)
    mgmqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeei
    tdrillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsav
    llekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uoiI (I:)
    mqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitd
    rillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavll
    ekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3uoiJ (J:)
    mgmqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeei
    tdrillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsav
    llekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uoiJ (J:)
    mqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitd
    rillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavll
    ekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3uoiK (K:)
    mgmqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeei
    tdrillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsav
    llekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uoiK (K:)
    mqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitd
    rillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavll
    ekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3uoiL (L:)
    mgmqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeei
    tdrillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsav
    llekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uoiL (L:)
    mqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitd
    rillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavll
    ekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3uoiM (M:)
    mgmqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeei
    tdrillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsav
    llekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uoiM (M:)
    mqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitd
    rillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavll
    ekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3uoiN (N:)
    mgmqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeei
    tdrillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsav
    llekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uoiN (N:)
    mqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitd
    rillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavll
    ekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3uoiO (O:)
    mgmqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeei
    tdrillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsav
    llekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uoiO (O:)
    mqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitd
    rillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavll
    ekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3uoiP (P:)
    mgmqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeei
    tdrillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsav
    llekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uoiP (P:)
    mqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitd
    rillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavll
    ekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3uoiQ (Q:)
    mgmqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeei
    tdrillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsav
    llekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uoiQ (Q:)
    mqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitd
    rillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavll
    ekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3uoiR (R:)
    mgmqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeei
    tdrillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsav
    llekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uoiR (R:)
    mqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitd
    rillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavll
    ekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3uoiS (S:)
    mgmqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeei
    tdrillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsav
    llekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uoiS (S:)
    mqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitd
    rillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavll
    ekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3uoiT (T:)
    mgmqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeei
    tdrillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsav
    llekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uoiT (T:)
    mqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitd
    rillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavll
    ekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3uoiU (U:)
    mgmqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeei
    tdrillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsav
    llekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uoiU (U:)
    mqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitd
    rillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavll
    ekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

  • Chain 'V':
    No sequence available.

  • Chain 'W':
    No sequence available.

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3uoiX (X:)
    mgmqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeei
    tdrillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsav
    llekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uoiX (X:)
    mqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitd
    rillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavll
    ekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

  • Chain 'a':
    No sequence available.

  • Chain 'b':
    No sequence available.

  • Chain 'c':
    No sequence available.

  • Chain 'd':
    No sequence available.

  • Chain 'e':
    No sequence available.

  • Chain 'f':
    No sequence available.

  • Chain 'g':
    No sequence available.

  • Chain 'h':
    No sequence available.

  • Chain 'i':
    No sequence available.

  • Chain 'j':
    No sequence available.

  • Chain 'k':
    No sequence available.

  • Chain 'l':
    No sequence available.

  • Chain 'm':
    No sequence available.

  • Chain 'n':
    No sequence available.

  • Chain 'o':
    No sequence available.

  • Chain 'p':
    No sequence available.

  • Chain 'q':
    No sequence available.

  • Chain 'r':
    No sequence available.

  • Chain 's':
    No sequence available.

  • Chain 't':
    No sequence available.

  • Chain 'u':
    No sequence available.

  • Chain 'v':
    Sequence, based on SEQRES records: (download)
    >3uoiv (v:)
    mgmqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeei
    tdrillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsav
    llekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uoiv (v:)
    mqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitd
    rillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavll
    ekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

  • Chain 'w':
    Sequence, based on SEQRES records: (download)
    >3uoiw (w:)
    mgmqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeei
    tdrillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsav
    llekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uoiw (w:)
    mqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitd
    rillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavll
    ekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

  • Chain 'x':
    No sequence available.