PDB entry 3uof

View 3uof on RCSB PDB site
Description: Mycobacterium tuberculosis bacterioferritin, BfrA
Class: oxidoreductase
Keywords: Structural Genomics, TB Structural Genomics Consortium, TBSGC, bacterioferritin, ferroxidation and iron storage, cytosol, OXIDOREDUCTASE
Deposited on 2011-11-16, released 2012-11-21
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-11-21, with a file datestamp of 2012-11-16.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.213
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3uofa_
  • Chain 'B':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3uofb_
  • Chain 'C':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3uofc_
  • Chain 'D':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3uofd_
  • Chain 'E':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3uofe_
  • Chain 'F':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: bfr, bfrA, MT1925, MTCY180.42c, Rv1876
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3uoff_
  • Heterogens: FE, TRS, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3uofA (A:)
    mgmqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeei
    tdrillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsav
    llekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uofA (A:)
    mqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitd
    rillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavll
    ekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3uofB (B:)
    mgmqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeei
    tdrillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsav
    llekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uofB (B:)
    mqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitd
    rillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavll
    ekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3uofC (C:)
    mgmqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeei
    tdrillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsav
    llekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uofC (C:)
    mqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitd
    rillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavll
    ekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3uofD (D:)
    mgmqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeei
    tdrillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsav
    llekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uofD (D:)
    mqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitd
    rillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavll
    ekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3uofE (E:)
    mgmqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeei
    tdrillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsav
    llekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uofE (E:)
    mqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitd
    rillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavll
    ekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3uofF (F:)
    mgmqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeei
    tdrillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsav
    llekivadeeehidyletqlelmdklgeelysaqcvsrppt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uofF (F:)
    mqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitd
    rillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavll
    ekivadeeehidyletqlelmdklgeelysaqcvsrppt