PDB entry 3uod

View 3uod on RCSB PDB site
Description: Aurora A in complex with RPM1693
Class: transferase/transferase inhibitor
Keywords: protein kinase, aurora A, inhibitor, DFG-in, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2011-11-16, released 2012-01-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-05-02, with a file datestamp of 2012-04-27.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.205
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aurora kinase A
    Species: Homo sapiens [TaxId:9606]
    Gene: AURKA, AIK, AIRK1, ARK1, AURA, AYK1, BTAK, IAK1, STK15, STK6
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14965
      • engineered mutation (164)
    Domains in SCOPe 2.06: d3uoda_
  • Heterogens: 0C3, EDO, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3uodA (A:)
    skkrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrrev
    eiqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelan
    alsychskrvihrdikpenlllgsagelkiadfgwsvhapssrrdtlcgtldylppemie
    grmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisr
    llkhnpsqrpmlrevlehpwitansskpsncqnkesask
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uodA (A:)
    kkrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreve
    iqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelana
    lsychskrvihrdikpenlllgsagelkiadfgwsvhapssrrdtlcgtldylppemieg
    rmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrl
    lkhnpsqrpmlrevlehpwitanssk