PDB entry 3umx

View 3umx on RCSB PDB site
Description: Crystal structure of Pim1 kinase in complex with inhibitor (Z)-2-[(1H-indol-3-yl)methylene]-7-(azepan-1-ylmethyl)-6-hydroxybenzofuran-3(2H)-one
Class: transferase/inhibitor
Keywords: Pim-1, kinase, P-loop, kinase inhibitor, rational drug design, TRANSFERASE-INHIBITOR complex
Deposited on 2011-11-15, released 2012-08-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-10-03, with a file datestamp of 2012-09-28.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.18
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene serine/threonine-protein kinase Pim-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PIM1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3umxa_
  • Heterogens: Q18, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3umxA (A:)
    mkekeplesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvp
    mevvllkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsf
    fwqvleavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvy
    sppewiryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhli
    rwclalrpsdrptfeeiqnhpwmqdvllpqetaeihlhslspgpsksgpssgenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3umxA (A:)
    qyqvgpllgsggfgsvysgirvnlpvaikhvekdrisdwgervpmevvllkkvssgfsgv
    irlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvleavrhchncgv
    lhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppewiryhryhgrsa
    avwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwclalrpsdrptfee
    iqnhpwmqdvllpqetaeihl