PDB entry 3umg

View 3umg on RCSB PDB site
Description: Crystal Structure of the Defluorinating L-2-Haloacid Dehalogenase Rha0230
Class: hydrolase
Keywords: Haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, HYDROLASE
Deposited on 2011-11-13, released 2012-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-11-14, with a file datestamp of 2012-11-09.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.215
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Haloacid dehalogenase
    Species: Rhodococcus jostii [TaxId:101510]
    Gene: RHA1_ro00230
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3umga_
  • Chain 'B':
    Compound: Haloacid dehalogenase
    Species: Rhodococcus jostii [TaxId:101510]
    Gene: RHA1_ro00230
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3umgb_
  • Chain 'C':
    Compound: Haloacid dehalogenase
    Species: Rhodococcus jostii [TaxId:101510]
    Gene: RHA1_ro00230
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3umgc_
  • Chain 'D':
    Compound: Haloacid dehalogenase
    Species: Rhodococcus jostii [TaxId:101510]
    Gene: RHA1_ro00230
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3umgd_
  • Chain 'E':
    Compound: Haloacid dehalogenase
    Species: Rhodococcus jostii [TaxId:101510]
    Gene: RHA1_ro00230
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3umge_
  • Chain 'F':
    Compound: Haloacid dehalogenase
    Species: Rhodococcus jostii [TaxId:101510]
    Gene: RHA1_ro00230
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3umgf_
  • Chain 'G':
    Compound: Haloacid dehalogenase
    Species: Rhodococcus jostii [TaxId:101510]
    Gene: RHA1_ro00230
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3umgg_
  • Chain 'H':
    Compound: Haloacid dehalogenase
    Species: Rhodococcus jostii [TaxId:101510]
    Gene: RHA1_ro00230
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3umgh_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3umgA (A:)
    magvpfrspstgrnvravlfdtfgtvvdwrtgiatavadyaarhqlevdavafadrwrar
    yqpsmdailsgarefvtldilhrenldfvlresgidptnhdsgeldelarawhvltpwpd
    svpgltaikaeyiigplsngntsllldmaknagipwdviigsdinrkykpdpqaylrtaq
    vlglhpgevmlaaahngdleaahatglatafilrpvehgphqtddlaptgswdisatdit
    dlaaqlragstgfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3umgA (A:)
    vpfrspstgrnvravlfdtfgtvvdwrtgiatavadyaarhqlevdavafadrwraryqp
    smdailsgarefvtldilhrenldfvlresgidptnhdsgeldelarawhvltpwpdsvp
    gltaikaeyiigplsngntsllldmaknagipwdviigsdinrkykpdpqaylrtaqvlg
    lhpgevmlaaahngdleaahatglatafilrpvehgphqtddlaptgswdisatditdla
    aqlrags
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3umgB (B:)
    magvpfrspstgrnvravlfdtfgtvvdwrtgiatavadyaarhqlevdavafadrwrar
    yqpsmdailsgarefvtldilhrenldfvlresgidptnhdsgeldelarawhvltpwpd
    svpgltaikaeyiigplsngntsllldmaknagipwdviigsdinrkykpdpqaylrtaq
    vlglhpgevmlaaahngdleaahatglatafilrpvehgphqtddlaptgswdisatdit
    dlaaqlragstgfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3umgB (B:)
    gvpfrspstgrnvravlfdtfgtvvdwrtgiatavadyaarhqlevdavafadrwraryq
    psmdailsgarefvtldilhrenldfvlresgidptnhdsgeldelarawhvltpwpdsv
    pgltaikaeyiigplsngntsllldmaknagipwdviigsdinrkykpdpqaylrtaqvl
    glhpgevmlaaahngdleaahatglatafilrpvehgphqtddlaptgswdisatditdl
    aaqlrag
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3umgC (C:)
    magvpfrspstgrnvravlfdtfgtvvdwrtgiatavadyaarhqlevdavafadrwrar
    yqpsmdailsgarefvtldilhrenldfvlresgidptnhdsgeldelarawhvltpwpd
    svpgltaikaeyiigplsngntsllldmaknagipwdviigsdinrkykpdpqaylrtaq
    vlglhpgevmlaaahngdleaahatglatafilrpvehgphqtddlaptgswdisatdit
    dlaaqlragstgfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3umgC (C:)
    vpfrspstgrnvravlfdtfgtvvdwrtgiatavadyaarhqlevdavafadrwraryqp
    smdailsgarefvtldilhrenldfvlresgidptnhdsgeldelarawhvltpwpdsvp
    gltaikaeyiigplsngntsllldmaknagipwdviigsdinrkykpdpqaylrtaqvlg
    lhpgevmlaaahngdleaahatglatafilrpvehgphqtddlaptgswdisatditdla
    aqlra
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3umgD (D:)
    magvpfrspstgrnvravlfdtfgtvvdwrtgiatavadyaarhqlevdavafadrwrar
    yqpsmdailsgarefvtldilhrenldfvlresgidptnhdsgeldelarawhvltpwpd
    svpgltaikaeyiigplsngntsllldmaknagipwdviigsdinrkykpdpqaylrtaq
    vlglhpgevmlaaahngdleaahatglatafilrpvehgphqtddlaptgswdisatdit
    dlaaqlragstgfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3umgD (D:)
    gvpfrspstgrnvravlfdtfgtvvdwrtgiatavadyaarhqlevdavafadrwraryq
    psmdailsgarefvtldilhrenldfvlresgidptnhdsgeldelarawhvltpwpdsv
    pgltaikaeyiigplsngntsllldmaknagipwdviigsdinrkykpdpqaylrtaqvl
    glhpgevmlaaahngdleaahatglatafilrpvehgphqtddlaptgswdisatditdl
    aaqlrags
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3umgE (E:)
    magvpfrspstgrnvravlfdtfgtvvdwrtgiatavadyaarhqlevdavafadrwrar
    yqpsmdailsgarefvtldilhrenldfvlresgidptnhdsgeldelarawhvltpwpd
    svpgltaikaeyiigplsngntsllldmaknagipwdviigsdinrkykpdpqaylrtaq
    vlglhpgevmlaaahngdleaahatglatafilrpvehgphqtddlaptgswdisatdit
    dlaaqlragstgfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3umgE (E:)
    vpfrspstgrnvravlfdtfgtvvdwrtgiatavadyaarhqlevdavafadrwraryqp
    smdailsgarefvtldilhrenldfvlresgidptnhdsgeldelarawhvltpwpdsvp
    gltaikaeyiigplsngntsllldmaknagipwdviigsdinrkykpdpqaylrtaqvlg
    lhpgevmlaaahngdleaahatglatafilrpvehgphqtddlaptgswdisatditdla
    aqlragst
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3umgF (F:)
    magvpfrspstgrnvravlfdtfgtvvdwrtgiatavadyaarhqlevdavafadrwrar
    yqpsmdailsgarefvtldilhrenldfvlresgidptnhdsgeldelarawhvltpwpd
    svpgltaikaeyiigplsngntsllldmaknagipwdviigsdinrkykpdpqaylrtaq
    vlglhpgevmlaaahngdleaahatglatafilrpvehgphqtddlaptgswdisatdit
    dlaaqlragstgfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3umgF (F:)
    vpfrspstgrnvravlfdtfgtvvdwrtgiatavadyaarhqlevdavafadrwraryqp
    smdailsgarefvtldilhrenldfvlresgidptnhdsgeldelarawhvltpwpdsvp
    gltaikaeyiigplsngntsllldmaknagipwdviigsdinrkykpdpqaylrtaqvlg
    lhpgevmlaaahngdleaahatglatafilrpvehgphqtddlaptgswdisatditdla
    aqlra
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3umgG (G:)
    magvpfrspstgrnvravlfdtfgtvvdwrtgiatavadyaarhqlevdavafadrwrar
    yqpsmdailsgarefvtldilhrenldfvlresgidptnhdsgeldelarawhvltpwpd
    svpgltaikaeyiigplsngntsllldmaknagipwdviigsdinrkykpdpqaylrtaq
    vlglhpgevmlaaahngdleaahatglatafilrpvehgphqtddlaptgswdisatdit
    dlaaqlragstgfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3umgG (G:)
    vpfrspstgrnvravlfdtfgtvvdwrtgiatavadyaarhqlevdavafadrwraryqp
    smdailsgarefvtldilhrenldfvlresgidptnhdsgeldelarawhvltpwpdsvp
    gltaikaeyiigplsngntsllldmaknagipwdviigsdinrkykpdpqaylrtaqvlg
    lhpgevmlaaahngdleaahatglatafilrpvehgphqtddlaptgswdisatditdla
    aqlrag
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3umgH (H:)
    magvpfrspstgrnvravlfdtfgtvvdwrtgiatavadyaarhqlevdavafadrwrar
    yqpsmdailsgarefvtldilhrenldfvlresgidptnhdsgeldelarawhvltpwpd
    svpgltaikaeyiigplsngntsllldmaknagipwdviigsdinrkykpdpqaylrtaq
    vlglhpgevmlaaahngdleaahatglatafilrpvehgphqtddlaptgswdisatdit
    dlaaqlragstgfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3umgH (H:)
    pfrspstgrnvravlfdtfgtvvdwrtgiatavadyaarhqlevdavafadrwraryqps
    mdailsgarefvtldilhrenldfvlresgidptnhdsgeldelarawhvltpwpdsvpg
    ltaikaeyiigplsngntsllldmaknagipwdviigsdinrkykpdpqaylrtaqvlgl
    hpgevmlaaahngdleaahatglatafilrpvehgphqtddlaptgswdisatditdlaa
    qlrag