PDB entry 3ulr

View 3ulr on RCSB PDB site
Description: Lysozyme contamination facilitates crystallization of a hetero-trimericCortactin:Arg:Lysozyme complex
Class: hydrolase, protein binding
Keywords: SH3, Protein-protein interaction, HYDROLASE, PROTEIN BINDING
Deposited on 2011-11-11, released 2012-01-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-02-15, with a file datestamp of 2012-02-10.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.186
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysozyme C
    Species: Gallus gallus [TaxId:9031]
    Gene: LYZ
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Src substrate cortactin
    Species: Mus musculus [TaxId:10090]
    Gene: Cttn, Ems1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q60598 (5-64)
      • expression tag (1-4)
    Domains in SCOPe 2.04: d3ulrb_
  • Chain 'C':
    Compound: Abelson tyrosine-protein kinase 2
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ulrB (B:)
    gplgssdlgitaialydyqaagddeisfdpddiitniemiddgwwrgvckgryglfpany
    velrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ulrB (B:)
    plgssdlgitaialydyqaagddeisfdpddiitniemiddgwwrgvckgryglfpanyv
    elrq
    

  • Chain 'C':
    No sequence available.