PDB entry 3ulq

View 3ulq on RCSB PDB site
Description: Crystal Structure of the Anti-Activator RapF Complexed with the Response Regulator ComA DNA Binding Domain
Class: gene regulation/transcription activator
Keywords: TETRATRICOPEPTIDE REPEAT, RESPONSE REGULATOR HELIX-TURN-HELX DNA BINDING, 3-HELIX BUNDLE, HYDROLASE-TRANSCRIPTION ACTIVATOR complex, GENE REGULATION-TRANSCRIPTION ACTIVATOR complex
Deposited on 2011-11-11, released 2012-01-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-01-25, with a file datestamp of 2012-01-20.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.191
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Response regulator aspartate phosphatase F
    Species: Bacillus subtilis [TaxId:1423]
    Gene: rapF, ywhJ, BSU37460
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Transcriptional regulatory protein comA
    Species: Bacillus subtilis [TaxId:1423]
    Gene: comA, comA1, comAA, BSU31680
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ulqb_
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ulqB (B:)
    mgsshhhhhhssglvprgshmssqkeqdvltpreclilqevekgftnqeiadalhlskrs
    ieysltsifnklnvgsrteavliaksdgvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ulqB (B:)
    vltpreclilqevekgftnqeiadalhlskrsieysltsifnklnvgsrteavliaks