PDB entry 3ull

View 3ull on RCSB PDB site
Description: human mitochondrial single-stranded DNA binding protein
Class: DNA-binding protein
Keywords: DNA-binding protein, DNA replication, mitochondrion, transit peptide
Deposited on 1996-12-11, released 1997-10-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.195
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA binding protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3ulla_
  • Chain 'B':
    Compound: DNA binding protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3ullb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ullA (A:)
    esetttslvlerslnrvhllgrvgqdpvlrqvegknpvtifslatnemwrsgdsevyqlg
    dvsqkttwhrisvfrpglrdvayqyvkkgsriylegkidygeymdknnvrrqattiiadn
    iiflsdqtkeke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ullA (A:)
    lerslnrvhllgrvgqdpvlrqvegknpvtifslatnemwrsdvsqkttwhrisvfrpgl
    rdvayqyvkkgsriylegkidygeymdknnvrrqattiiadniifl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ullB (B:)
    esetttslvlerslnrvhllgrvgqdpvlrqvegknpvtifslatnemwrsgdsevyqlg
    dvsqkttwhrisvfrpglrdvayqyvkkgsriylegkidygeymdknnvrrqattiiadn
    iiflsdqtkeke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ullB (B:)
    lerslnrvhllgrvgqdpvlrqvegknpvtifslatnemwrskttwhrisvfrpglrdva
    yqyvkkgsriylegkidygeymdknnvrrqattiiadniifls