PDB entry 3ulj

View 3ulj on RCSB PDB site
Description: Crystal structure of apo Lin28B cold shock domain
Class: DNA binding protein
Keywords: beta barrel, cold shock domain fold, nucleic acid binding, DNA BINDING PROTEIN
Deposited on 2011-11-10, released 2012-08-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-10-24, with a file datestamp of 2012-10-19.
Experiment type: XRAY
Resolution: 1.06 Å
R-factor: 0.121
AEROSPACI score: 0.97 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lin28b, DNA-binding protein
    Species: Xenopus (Silurana) tropicalis [TaxId:8364]
    Gene: lin28b
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ulja_
  • Chain 'B':
    Compound: Lin28b, DNA-binding protein
    Species: Xenopus (Silurana) tropicalis [TaxId:8364]
    Gene: lin28b
    Database cross-references and differences (RAF-indexed):
    • Uniprot B4F6I0 (2-89)
      • expression tag (0-1)
    Domains in SCOPe 2.04: d3uljb_
  • Heterogens: ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3uljA (A:)
    gsdpqvlrgsghckwfnvrmgfgfismtsregsplenpvdvfvhqsklymegfrslkege
    pveftfkksskgfeslrvtgpggnpclgne
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uljA (A:)
    pqvlrgsghckwfnvrmgfgfismtsregsplenpvdvfvhqsklymegfrslkegepve
    ftfkksskgfeslrvtgpggnpclgne
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3uljB (B:)
    gsdpqvlrgsghckwfnvrmgfgfismtsregsplenpvdvfvhqsklymegfrslkege
    pveftfkksskgfeslrvtgpggnpclgne