PDB entry 3ulh

View 3ulh on RCSB PDB site
Description: Crystal structure of a RNA binding domain of THO complex subunit 4 protein (THOC4) from Homo sapiens at 2.54 A resolution
Class: RNA binding protein
Keywords: nuclear protein, RNA binding, THO complex, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-BIOLOGY, RNA BINDING PROTEIN, Partnership for T-Cell Biology
Deposited on 2011-11-10, released 2011-12-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-12-07, with a file datestamp of 2011-12-02.
Experiment type: XRAY
Resolution: 2.54 Å
R-factor: 0.182
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: THO complex subunit 4
    Species: Homo sapiens [TaxId:9606]
    Gene: ALY, BC052302, BEF, THOC4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ulha_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ulhA (A:)
    gsrpkqlpdkwqhdlfdsgfgggagvetggkllvsnldfgvsdadiqelfaefgtlkkaa
    vhydrsgrslgtadvhferkadalkamkqyngvpldgrpmniqlvts
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ulhA (A:)
    agvetggkllvsnldfgvsdadiqelfaefgtlkkaavhydrsgrslgtadvhferkada
    lkamkqyngvpldgrpmniqlvts