PDB entry 3ule

View 3ule on RCSB PDB site
Description: Structure of Bos taurus Arp2/3 complex with bound inhibitor CK-869 and ATP
Class: structural protein
Keywords: beta-propellor, STRUCTURAL PROTEIN, ACTIN FILAMENT NUCLEATOR
Deposited on 2011-11-10, released 2013-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-13, with a file datestamp of 2013-02-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.223
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Actin-related protein 3
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ulea1, d3ulea2
  • Chain 'B':
    Compound: Actin-related Protein 2
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3uleb1
  • Chain 'C':
    Compound: Actin-related protein 2/3 complex subunit 1B
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ulec_
  • Chain 'D':
    Compound: Actin-related protein 2/3 complex subunit 2
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3uled1, d3uled2
  • Chain 'E':
    Compound: Actin-related protein 2/3 complex subunit 3
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ulee_
  • Chain 'F':
    Compound: Actin-related protein 2/3 complex subunit 4
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ulef_
  • Chain 'G':
    Compound: Actin-related protein 2/3 complex subunit 5
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3uleg_
  • Heterogens: ATP, C69, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3uleA (A:)
    magrlpacvvdcgtgytklgyagntepqfiipsciaikesakvgdqaqrrvmkgvddldf
    figdeaiekptyatkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntp
    enreytaeimfesfnvpglyiavqavlalaaswtsrqvgertltgtvidsgdgvthvipv
    aegyvigscikhipiagrdityfiqqllrdrevgippeqsletakavkerysyvcpdlvk
    efnkydtdgskwikqytginaiskkefsidvgyerflgpeiffhpefanpdftqpisevv
    deviqncpidvrrplyknivlsggstmfrdfgrrlqrdlkrtvdarlklseelsggrlkp
    kpidvqvithhmqryavwfggsmlastpefyqvchtkkdyeeigpsicrhnpvfgvms
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uleA (A:)
    agrlpacvvdcgtgytklgyagntepqfiipsciaikevmkgvddldffigdeaiekpty
    atkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpenreytaeimfe
    sfnvpglyiavqavlalaaswtsrqvgertltgtvidsgdgvthvipvaegyvigscikh
    ipiagrdityfiqqllrdrevgippeqsletakavkerysyvcpdlvkefnkydtdgskw
    ikqytginaiskkefsidvgyerflgpeiffhpefanpdftqpisevvdeviqncpidvr
    rplyknivlsggstmfrdfgrrlqrdlkrtvdarlklseelskpkpidvqvithhmqrya
    vwfggsmlastpefyqvchtkkdyeeigpsicrhnpvfgv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3uleB (B:)
    mdsqgrkvvvcdngtgfvkcgyagsnfpehifpalvgrpiirsttkvgnieikdlmvgde
    aselrsmlevnypmengivrnwddmkhlwdytfgpeklnidtrnckillteppmnptknr
    ekivevmfetyqfsgvyvaiqavltlyaqglltgvvvdsgdgvthicpvyegfslphltr
    rldiagrditrylikllllrgyafnhsadfetvrmikeklcyvgynieqeqklalettvl
    vesytlpdgriikvggerfeapealfqphlinvegvgvaellfntiqaadidtrsefykh
    ivlsggstmypglpsrlerelkqlylervlkgdveklskfkiriedpprrkhmvflggav
    ladimkdkdnfwmtrqeyqekgvrvleklgvtvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uleB (B:)
    cdngtgfvllteppmaiqavltlyaqglltgvvvdsgdgvthicpvyegfslphltrrld
    iagrditrylikllllrgyafnhsadfetvrmikeklcyvgynieqeqklalettvlves
    ytlpdgriikvggerfeapealfqphlinvegvgvaellfntiqaadidtrsefykhivl
    sggstmypglpsrlerelkqlylervlkgdveklskfkiriedpprhmvflggavl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3uleC (C:)
    mayhsflvepischawnkdrtqiaicpnnhevhiyeksgnkwvqvhelkehngqvtgidw
    apdsnrivtcgtdrnayvwtlkgrtwkptlvilrinraarcvrwapnekkfavgsgsrvi
    sicyfeqendwwvckhikkpirstvlsldwhpnsvllaagscdfkcrifsayikeveerp
    aptpwgskmpfgelmfesssscgwvhgvcfsangsrvawvshdstvcladadkkmavatl
    asetlpllavtfitesslvaaghdcfpvlftydsaagklsfggrldvpkqssqrgltare
    rfqnldkkassegsaaagagldslhknsvsqisvlsggkakcsqfcttgmdggmsiwdvr
    slesalkdlkiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uleC (C:)
    ayhsflvepischawnkdrtqiaicpnnhevhiyeksgnkwvqvhelkehngqvtgidwa
    pdsnrivtcgtdrnayvwtlkgrtwkptlvilrinraarcvrwapnekkfavgsgsrvis
    icyfeqendwwvckhikkpirstvlsldwhpnsvllaagscdfkcrifsayikeveerpa
    ptpwgskmpfgelmfesssscgwvhgvcfsangsrvawvshdstvcladadkkmavatla
    setlpllavtfitesslvaaghdcfpvlftydsaagklsfggrldvpagldslhknsvsq
    isvlsggkakcsqfcttgmdggmsiwdvrslesalkdlkiv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3uleD (D:)
    millevnnriieetlalkfenaaagnkpeavevtfadfdgvlyhisnpngdktkvmvsis
    lkfykelqahgadellkrvygsylvnpesgynvsllydlenlpaskdsivhqagmlkrnc
    fasvfekyfqfqeegkegenravihyrddetmyveskkdrvtvvfstvfkddddvvigkv
    fmqefkegrrashtapqvlfshrepplelkdtdaavgdnigyitfvlfprhtnasardnt
    inlihtfrdylhyhikcskayihtrmraktsdflkvlnrarpdaekkemktitgktfssr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uleD (D:)
    millevnnriieetlalkfenaaagnkpeavevtfadfdgvlyhisnpngdktkvmvsis
    lkfykelqahgadellkrvygsylvnpesgynvsllydlenlpaskdsivhqagmlkrnc
    fasvfekyfqfqeegkegenravihyrddetmyveskkdrvtvvfstvfkddddvvigkv
    fmqefkegrrashtapqvlfshrepplelktdaavgdnigyitfvlfprhtnasardnti
    nlihtfrdylhyhikcskayihtrmraktsdflkvlnrarp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3uleE (E:)
    mpayhsslmdpdtklignmallpirsqfkgpapretkdtdivdeaiyyfkanvffknyei
    kneadrtliyitlyiseclkklqkcnsksqgekemytlgitnfpipgepgfplnaiyakp
    ankqedevmraylqqlrqetglrlcekvfdpqndkpskwwtcfvkrqfmnkslsgpgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uleE (E:)
    payhsslmdpdtklignmallpirsqfkgpapretkdtdivdeaiyyfkanvffknyeik
    neadrtliyitlyiseclkklqkcnsksqgekemytlgitnfpipgepgfplnaiyakpa
    nkqedevmraylqqlrqetglrlcekvfdpqndkpskwwtcfvkrqfmnkslsg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3uleF (F:)
    mtatlrpylsavratlqaalclenfssqvverhnkpevevrsskelllqpvtisrnekek
    vliegsinsvrvsiavkqadeiekilchkfmrfmmmraenffilrrkpvegydisflitn
    fhteqmykhklvdfvihfmeeidkeisemklsvnararivaeeflknf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uleF (F:)
    tatlrpylsavratlqaalclenfssqvverhnkpevevrsskelllqpvtisrnekekv
    liegsinsvrvsiavkqadeiekilchkfmrfmmmraenffilrrkpvegydisflitnf
    hteqmykhklvdfvihfmeeidkeisemklsvnararivaeeflknf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3uleG (G:)
    mskntvssarfrkvdvgeydenkfvdeedggdgqagpdegevdsclrqgnmtaalqaalk
    nppintksqavkdragsivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdn
    ssavllqwhekalaaggvgsivrvltarktv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uleG (G:)
    arfrkvdvgeydenkfvdeeagpdegevdsclrqgnmtaalqaalknppintksqavkdr
    agsivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdnssavllqwhekala
    aggvgsivrvltarktv