PDB entry 3ul4

View 3ul4 on RCSB PDB site
Description: Crystal structure of Coh-OlpA(Cthe_3080)-Doc918(Cthe_0918) complex: A novel type I Cohesin-Dockerin complex from Clostridium thermocellum ATTC 27405
Class: cell adhesion/protein binding
Keywords: CELLULOSOME, COHESIN, DOCKERIN, TYPE I COHESIN-DOCKERIN COMPLEX, PROTEIN-PROTEIN INTERACTION, CLOSTRIDIUM THERMOCELLUM, CELL ADHESION, CELL ADHESION-PROTEIN BINDING complex
Deposited on 2011-11-10, released 2012-11-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-01-30, with a file datestamp of 2013-01-25.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.176
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellulosome-anchoring protein
    Species: Clostridium thermocellum [TaxId:203119]
    Gene: ancA, Cthe_3080
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3ul4a_
  • Chain 'B':
    Compound: cellulosome enzyme, dockerin type I
    Species: Clostridium thermocellum [TaxId:203119]
    Gene: Cthe_0918
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3ul4b_
  • Heterogens: SO4, PEG, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ul4A (A:)
    masqtntieiiignvkarpgdrievpvslknvpdkgivssdfvieydsklfkvielkagd
    ivenpsesfsynvvekdeiiavlyleetglgieairtdgvfftivmevskdvkpgispik
    fesfgatadndmnemtpklvegkveiiealehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ul4A (A:)
    ntieiiignvkarpgdrievpvslknvpdkgivssdfvieydsklfkvielkagdivenp
    sesfsynvvekdeiiavlyleetglgieairtdgvfftivmevskdvkpgispikfesfg
    atadndmnemtpklvegkveii
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ul4B (B:)
    mvvlngdlnrngivndedyillknyllrgnklvidlnvadvnkdgkvnstdclflkkyil
    gliti
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ul4B (B:)
    vlngdlnrngivndedyillknyllrgnklvidlnvadvnkdgkvnstdclflkkyilgl
    iti