PDB entry 3uje

View 3uje on RCSB PDB site
Description: Asymmetric complex of human neuron specific enolase-3-PGA/PEP
Class: lyase
Keywords: lyase
Deposited on 2011-11-07, released 2012-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gamma-enolase
    Species: Homo sapiens [TaxId:9606]
    Gene: ENO2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ujea1, d3ujea2
  • Chain 'B':
    Compound: Gamma-enolase
    Species: Homo sapiens [TaxId:9606]
    Gene: ENO2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ujeb1, d3ujeb2
  • Heterogens: MG, 2PG, TRS, PEP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ujeA (A:)
    siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
    vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
    gaaerelplyrhiaqlagnsdlilpvpafnvinggshagnklamqefmilpvgaesfrda
    mrlgaevyhtlkgvikdkygkdatnvgdeggfapnilensealelvkeaidkagytekiv
    igmdvaasefyrdgkydldfksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqddw
    aawskftanvgiqivgddltvtnpkrieraveekacnclllkvnqigsvteaiqacklaq
    engwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqlmrieeelgdea
    rfaghnfrnpsvlhhhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ujeA (A:)
    siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
    vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
    gaaerelplyrhiaqlagnsdlilpvpafnvinggshagnklamqefmilpvgaesfrda
    mrlgaevyhtlkgvikdkygkdatnvgdeggfapnilensealelvkeaidkagytekiv
    igmdvaasefyrdgkydldfksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqddw
    aawskftanvgiqivgddltvtnpkrieraveekacnclllkvnqigsvteaiqacklaq
    engwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqlmrieeelgdea
    rfaghnfrnpsvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ujeB (B:)
    siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
    vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
    gaaerelplyrhiaqlagnsdlilpvpafnvinggshagnklamqefmilpvgaesfrda
    mrlgaevyhtlkgvikdkygkdatnvgdeggfapnilensealelvkeaidkagytekiv
    igmdvaasefyrdgkydldfksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqddw
    aawskftanvgiqivgddltvtnpkrieraveekacnclllkvnqigsvteaiqacklaq
    engwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqlmrieeelgdea
    rfaghnfrnpsvlhhhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ujeB (B:)
    siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
    vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
    gaaerelplyrhiaqlagnsdlilpvpafnvinggshagnklamqefmilpvgaesfrda
    mrlgaevyhtlkgvikdkygkdatnvgdeggfapnilensealelvkeaidkagytekiv
    igmdvaasefyrdgkydldfksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqddw
    aawskftanvgiqivgddltvtnpkrieraveekacnclllkvnqigsvteaiqacklaq
    engwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqlmrieeelgdea
    rfaghnfrnpsv