PDB entry 3uhk

View 3uhk on RCSB PDB site
Description: HBI (K96R) without ligand bound
Class: oxygen storage, oxygen transport
Keywords: allostery, oxygen binding, OXYGEN STORAGE, OXYGEN TRANSPORT
Deposited on 2011-11-03, released 2011-12-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Globin-1
    Species: Scapharca inaequivalvis [TaxId:6561]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02213 (Start-145)
      • engineered mutation (95)
    Domains in SCOPe 2.07: d3uhka_
  • Chain 'B':
    Compound: Globin-1
    Species: Scapharca inaequivalvis [TaxId:6561]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02213 (Start-145)
      • engineered mutation (95)
    Domains in SCOPe 2.07: d3uhkb_
  • Chain 'C':
    Compound: Globin-1
    Species: Scapharca inaequivalvis [TaxId:6561]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02213 (Start-145)
      • engineered mutation (95)
    Domains in SCOPe 2.07: d3uhkc_
  • Chain 'D':
    Compound: Globin-1
    Species: Scapharca inaequivalvis [TaxId:6561]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02213 (Start-145)
      • engineered mutation (95)
    Domains in SCOPe 2.07: d3uhkd_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3uhkA (A:)
    psvydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqg
    mandklrghsitlmyalqnfidqldnpddlvcvverfavnhitrkisaaefgkingpikk
    vlasknfgdkyanawaklvavvqaal
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uhkA (A:)
    svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqgm
    andklrghsitlmyalqnfidqldnpddlvcvverfavnhitrkisaaefgkingpikkv
    lasknfgdkyanawaklvavvqaal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3uhkB (B:)
    psvydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqg
    mandklrghsitlmyalqnfidqldnpddlvcvverfavnhitrkisaaefgkingpikk
    vlasknfgdkyanawaklvavvqaal
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uhkB (B:)
    svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqgm
    andklrghsitlmyalqnfidqldnpddlvcvverfavnhitrkisaaefgkingpikkv
    lasknfgdkyanawaklvavvqaal
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3uhkC (C:)
    psvydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqg
    mandklrghsitlmyalqnfidqldnpddlvcvverfavnhitrkisaaefgkingpikk
    vlasknfgdkyanawaklvavvqaal
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uhkC (C:)
    svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqgm
    andklrghsitlmyalqnfidqldnpddlvcvverfavnhitrkisaaefgkingpikkv
    lasknfgdkyanawaklvavvqaal
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3uhkD (D:)
    psvydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqg
    mandklrghsitlmyalqnfidqldnpddlvcvverfavnhitrkisaaefgkingpikk
    vlasknfgdkyanawaklvavvqaal
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uhkD (D:)
    svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqgm
    andklrghsitlmyalqnfidqldnpddlvcvverfavnhitrkisaaefgkingpikkv
    lasknfgdkyanawaklvavvqaal