PDB entry 3uhj

View 3uhj on RCSB PDB site
Description: Crystal structure of a probable glycerol dehydrogenase from Sinorhizobium meliloti 1021
Class: oxidoreductase
Keywords: Structural Genomics, PSI-Biology, New York Structural Genomics Research Consortium, NYSGRC, OXIDOREDUCTASE
Deposited on 2011-11-03, released 2011-11-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-11-23, with a file datestamp of 2011-11-18.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: 0.2
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable glycerol dehydrogenase
    Species: Sinorhizobium meliloti [TaxId:382]
    Gene: gldA, R02550, SMc02038
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3uhja_
  • Chain 'B':
    Compound: Probable glycerol dehydrogenase
    Species: Sinorhizobium meliloti [TaxId:382]
    Gene: gldA, R02550, SMc02038
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3uhjb_
  • Chain 'C':
    Compound: Probable glycerol dehydrogenase
    Species: Sinorhizobium meliloti [TaxId:382]
    Gene: gldA, R02550, SMc02038
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3uhjc_
  • Chain 'D':
    Compound: Probable glycerol dehydrogenase
    Species: Sinorhizobium meliloti [TaxId:382]
    Gene: gldA, R02550, SMc02038
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3uhjd_
  • Chain 'E':
    Compound: Probable glycerol dehydrogenase
    Species: Sinorhizobium meliloti [TaxId:382]
    Gene: gldA, R02550, SMc02038
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3uhje_
  • Chain 'F':
    Compound: Probable glycerol dehydrogenase
    Species: Sinorhizobium meliloti [TaxId:382]
    Gene: gldA, R02550, SMc02038
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3uhjf_
  • Chain 'G':
    Compound: Probable glycerol dehydrogenase
    Species: Sinorhizobium meliloti [TaxId:382]
    Gene: gldA, R02550, SMc02038
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3uhjg_
  • Chain 'H':
    Compound: Probable glycerol dehydrogenase
    Species: Sinorhizobium meliloti [TaxId:382]
    Gene: gldA, R02550, SMc02038
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3uhjh_
  • Heterogens: GOL, ZN, SE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3uhjA (A:)
    mhhhhhhssgvdlgtenlyfqsmmarafggpnkyiqrageidklaaylaplgkralvlid
    rvlfdalserigkscgdsldirferfggecctseiervrkvaiehgsdilvgvgggktad
    takivaidtgariviaptiastdapcsaiavrytehgvyeealrlprnpdavvvdsalva
    aaparflvagigdalstwfearsniesrtdnyvaggfpateagmaiarhcqdvltrdavk
    akiaveaglltpaveniieantllsglgfencgcsaahgihdgltvleevhgyfhgekva
    fgtlcllmlenrdraeieamirfcrsvglptkladlgivddvpakigrvaeaacrpgnii
    yatpvtitvpavrdailaldafsrsih
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uhjA (A:)
    marafggpnkyiqrageidklaaylaplgkralvlidrvlfdalserisldirferfgge
    cctseiervrkvaiehgsdilvgvgggktadtakivaidtgariviaptiastdapcsai
    avrytehgvyeealrlprnpdavvvdsalvaaaparflvagigdalstwfearsniesrt
    dnyvaggfpateagmaiarhcqdvltrdavkakiaveaglltpaveniieantllsglgf
    encgcsaahgihdgltvleevhgyfhgekvafgtlcllmlenrdraeieamirfcrsvgl
    ptkladlgivddvpakigrvaeaacrpgniiyatpvtitvpavrdailaldafsrsi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3uhjB (B:)
    mhhhhhhssgvdlgtenlyfqsmmarafggpnkyiqrageidklaaylaplgkralvlid
    rvlfdalserigkscgdsldirferfggecctseiervrkvaiehgsdilvgvgggktad
    takivaidtgariviaptiastdapcsaiavrytehgvyeealrlprnpdavvvdsalva
    aaparflvagigdalstwfearsniesrtdnyvaggfpateagmaiarhcqdvltrdavk
    akiaveaglltpaveniieantllsglgfencgcsaahgihdgltvleevhgyfhgekva
    fgtlcllmlenrdraeieamirfcrsvglptkladlgivddvpakigrvaeaacrpgnii
    yatpvtitvpavrdailaldafsrsih
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uhjB (B:)
    arafggpnkyiqrageidklaaylaplgkralvlidrvlfdalserisldirferfggec
    ctseiervrkvaiehgsdilvgvgggktadtakivaidtgariviaptiastdapcsaia
    vrytehgvyeealrlprnpdavvvdsalvaaaparflvagigdalstwfearsniesrtd
    nyvaggfpateagmaiarhcqdvltrdavkakiaveaglltpaveniieantllsglgfe
    ncgcsaahgihdgltvleevhgyfhgekvafgtlcllmlenrdraeieamirfcrsvglp
    tkladlgivddvpakigrvaeaacrpgniiyatpvtitvpavrdailaldafsrsi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3uhjC (C:)
    mhhhhhhssgvdlgtenlyfqsmmarafggpnkyiqrageidklaaylaplgkralvlid
    rvlfdalserigkscgdsldirferfggecctseiervrkvaiehgsdilvgvgggktad
    takivaidtgariviaptiastdapcsaiavrytehgvyeealrlprnpdavvvdsalva
    aaparflvagigdalstwfearsniesrtdnyvaggfpateagmaiarhcqdvltrdavk
    akiaveaglltpaveniieantllsglgfencgcsaahgihdgltvleevhgyfhgekva
    fgtlcllmlenrdraeieamirfcrsvglptkladlgivddvpakigrvaeaacrpgnii
    yatpvtitvpavrdailaldafsrsih
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uhjC (C:)
    arafggpnkyiqrageidklaaylaplgkralvlidrvlfdalserigsldirferfgge
    cctseiervrkvaiehgsdilvgvgggktadtakivaidtgariviaptiastdapcsai
    avrytehgvyeealrlprnpdavvvdsalvaaaparflvagigdalstwfearsniesrt
    dnyggfpateagmaiarhcqdvltrdavkakiaveaglltpaveniieantllsglgfen
    cgcsaahgihdgltvleevhgyfhgekvafgtlcllmlenrdraeieamirfcrsvglpt
    kladlgivddvpakigrvaeaacrpgniiyatpvtitvpavrdailaldafsrsi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3uhjD (D:)
    mhhhhhhssgvdlgtenlyfqsmmarafggpnkyiqrageidklaaylaplgkralvlid
    rvlfdalserigkscgdsldirferfggecctseiervrkvaiehgsdilvgvgggktad
    takivaidtgariviaptiastdapcsaiavrytehgvyeealrlprnpdavvvdsalva
    aaparflvagigdalstwfearsniesrtdnyvaggfpateagmaiarhcqdvltrdavk
    akiaveaglltpaveniieantllsglgfencgcsaahgihdgltvleevhgyfhgekva
    fgtlcllmlenrdraeieamirfcrsvglptkladlgivddvpakigrvaeaacrpgnii
    yatpvtitvpavrdailaldafsrsih
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uhjD (D:)
    arafggpnkyiqrageidklaaylaplgkralvlidrvlfdalserisldirferfggec
    ctseiervrkvaiehgsdilvgvgggktadtakivaidtgariviaptiastdapcsaia
    vrytehgvyeealrlprnpdavvvdsalvaaaparflvagigdalstwfearsniesrtd
    nyvaggfpateagmaiarhcqdvltrdavkakiaveaglltpaveniieantllsglgfe
    ncgcsaahgihdgltvleevhgyfhgekvafgtlcllmlenrdraeieamirfcrsvglp
    tkladlgivddvpakigrvaeaacrpgniiyatpvtitvpavrdailaldafsrsih
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3uhjE (E:)
    mhhhhhhssgvdlgtenlyfqsmmarafggpnkyiqrageidklaaylaplgkralvlid
    rvlfdalserigkscgdsldirferfggecctseiervrkvaiehgsdilvgvgggktad
    takivaidtgariviaptiastdapcsaiavrytehgvyeealrlprnpdavvvdsalva
    aaparflvagigdalstwfearsniesrtdnyvaggfpateagmaiarhcqdvltrdavk
    akiaveaglltpaveniieantllsglgfencgcsaahgihdgltvleevhgyfhgekva
    fgtlcllmlenrdraeieamirfcrsvglptkladlgivddvpakigrvaeaacrpgnii
    yatpvtitvpavrdailaldafsrsih
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uhjE (E:)
    arafggpnkyiqrageidklaaylaplgkralvlidrvlfdalserisldirferfggec
    ctseiervrkvaiehgsdilvgvgggktadtakivaidtgariviaptiastdapcsaia
    vrytehgvyeealrlprnpdavvvdsalvaaaparflvagigdalstwfearsniesrtd
    naggfpateagmaiarhcqdvltrdavkakiaveaglltpaveniieantllsglgfenc
    gcsaahgihdgltvleevhgyfhgekvafgtlcllmlenrdraeieamirfcrsvglptk
    ladlgivddvpakigrvaeaacrpgniiyatpvtitvpavrdailaldafsrsih
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3uhjF (F:)
    mhhhhhhssgvdlgtenlyfqsmmarafggpnkyiqrageidklaaylaplgkralvlid
    rvlfdalserigkscgdsldirferfggecctseiervrkvaiehgsdilvgvgggktad
    takivaidtgariviaptiastdapcsaiavrytehgvyeealrlprnpdavvvdsalva
    aaparflvagigdalstwfearsniesrtdnyvaggfpateagmaiarhcqdvltrdavk
    akiaveaglltpaveniieantllsglgfencgcsaahgihdgltvleevhgyfhgekva
    fgtlcllmlenrdraeieamirfcrsvglptkladlgivddvpakigrvaeaacrpgnii
    yatpvtitvpavrdailaldafsrsih
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uhjF (F:)
    arafggpnkyiqrageidklaaylaplgkralvlidrvlfdalserisldirferfggec
    ctseiervrkvaiehgsdilvgvgggktadtakivaidtgariviaptiastdapcsaia
    vrytehgvyeealrlprnpdavvvdsalvaaaparflvagigdalstwfearsniesrtd
    nfpateagmaiarhcqdvltrdavkakiaveaglltpaveniieantllsglgfencgcs
    aahgihdgltvleevhgyfhgekvafgtlcllmlenrdraeieamirfcrsvglptklad
    lgivddvpakigrvaeaacrpgniiyatpvtitvpavrdailaldafsrsi
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3uhjG (G:)
    mhhhhhhssgvdlgtenlyfqsmmarafggpnkyiqrageidklaaylaplgkralvlid
    rvlfdalserigkscgdsldirferfggecctseiervrkvaiehgsdilvgvgggktad
    takivaidtgariviaptiastdapcsaiavrytehgvyeealrlprnpdavvvdsalva
    aaparflvagigdalstwfearsniesrtdnyvaggfpateagmaiarhcqdvltrdavk
    akiaveaglltpaveniieantllsglgfencgcsaahgihdgltvleevhgyfhgekva
    fgtlcllmlenrdraeieamirfcrsvglptkladlgivddvpakigrvaeaacrpgnii
    yatpvtitvpavrdailaldafsrsih
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uhjG (G:)
    arafggpnkyiqrageidklaaylaplgkralvlidrvlfdalserisldirferfggec
    ctseiervrkvaiehgsdilvgvgggktadtakivaidtgariviaptiastdapcsaia
    vrytehgvyeealrlprnpdavvvdsalvaaaparflvagigdalstwfearsniesrtd
    nyvaggfpateagmaiarhcqdvltrdavkakiaveaglltpaveniieantllsglgfe
    ncgcsaahgihdgltvleevhgyfhgekvafgtlcllmlenrdraeieamirfcrsvglp
    tkladlgivddvpakigrvaeaacrpgniiyatpvtitvpavrdailaldafsrsi
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3uhjH (H:)
    mhhhhhhssgvdlgtenlyfqsmmarafggpnkyiqrageidklaaylaplgkralvlid
    rvlfdalserigkscgdsldirferfggecctseiervrkvaiehgsdilvgvgggktad
    takivaidtgariviaptiastdapcsaiavrytehgvyeealrlprnpdavvvdsalva
    aaparflvagigdalstwfearsniesrtdnyvaggfpateagmaiarhcqdvltrdavk
    akiaveaglltpaveniieantllsglgfencgcsaahgihdgltvleevhgyfhgekva
    fgtlcllmlenrdraeieamirfcrsvglptkladlgivddvpakigrvaeaacrpgnii
    yatpvtitvpavrdailaldafsrsih
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uhjH (H:)
    arafggpnkyiqrageidklaaylaplgkralvlidrvlfdalserisldirferfggec
    ctseiervrkvaiehgsdilvgvgggktadtakivaidtgariviaptiastdapcsaia
    vrytehgvyeealrlprnpdavvvdsalvaaaparflvagigdalstwfearsniesrtd
    nyvafpateagmaiarhcqdvltrdavkakiaveaglltpaveniieantllsglgfenc
    gcsaahgihdgltvleevhgyfhgekvafgtlcllmlenrdraeieamirfcrsvglptk
    ladlgivddvpakigrvaeaacrpgniiyatpvtitvpavrdailaldafsrsih