PDB entry 3uh0

View 3uh0 on RCSB PDB site
Description: Crystal structure of the yeast mitochondrial threonyl-tRNA synthetase (MST1) in complex with threonyl sulfamoyl adenylate
Class: ligase
Keywords: threonyl-tRNA synthetase, tRNA, threonine tRNA, threonyl adenylate, threonyl sulfamoyl adenylate, aminoacyl-tRNA synthetase class II, LIGASE
Deposited on 2011-11-03, released 2012-02-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-06-06, with a file datestamp of 2012-06-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.203
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Threonyl-tRNA synthetase, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: MST1, YKL194C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3uh0a1, d3uh0a2
  • Heterogens: ZN, TSB, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3uh0A (A:)
    mgsshhhhhhssglvprgshmasatknassatpatmtsmvsqrqdlfmtdplspgsmffl
    pngakifnkliefmklqqkfkfgfnevvtpliykktlweksghwenyaddmfkvettdee
    keeyglkpmncpghclifgkkdrsynelplrfsdfsplhrneasgalsgltrlrkfhqdd
    ghifctpsqvkseifnslklidivynkifpfvkggsgaesnyfinfstrpdhfigdlkvw
    nhaeqvlkeileesgkpwklnpgdgafygpkldimvtdhlrkthqvatiqldfqlperfd
    lkfkdqdnsykrpimihratfgsierfmallidsnegrwpfwlnpyqaviipvntknvqq
    ldmctalqkklrneleaddmepvplndwhfnvdldirnepvgyriksailknysyliivg
    deevqlqkynirerdnrksfekltmsqiwekfieleknyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uh0A (A:)
    satpatmtsmvsqrqdlfmtdplspgsmfflpngakifnkliefmklqqkfkfgfnevvt
    pliykktlweksghwenyaddmfkveteyglkpmncpghclifgkkdrsynelplrfsdf
    splhrneasgalsgltrlrkfhqddghifctpsqvkseifnslklidivynkifpfvaes
    nyfinfstrpdhfigdlkvwnhaeqvlkeileesgkpwklnpgdgafygpkldimvtdhl
    rkthqvatiqldfqlperfdlkfkdqdnsykrpimihratfgsierfmallidsnegrwp
    fwlnpyqaviipvntknvqqldmctalqkklrneleaddmepvplndwhfnvdldirnep
    vgyriksailknysyliivgdeevqlqkynirerdnrksfekltmsqiwekfieleknyk