PDB entry 3ugx

View 3ugx on RCSB PDB site
Description: Crystal Structure of Visual Arrestin
Class: signaling protein
Keywords: arrestin fold, signal termination, GPCR, outer segment, SIGNALING PROTEIN
Deposited on 2011-11-03, released 2012-02-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: S-arrestin
    Species: Bos taurus [TaxId:9913]
    Gene: SAG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ugxa1, d3ugxa2
  • Chain 'B':
    Compound: S-arrestin
    Species: Bos taurus [TaxId:9913]
    Gene: SAG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ugxb1, d3ugxb2
  • Chain 'C':
    Compound: S-arrestin
    Species: Bos taurus [TaxId:9913]
    Gene: SAG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ugxc1, d3ugxc2
  • Chain 'D':
    Compound: S-arrestin
    Species: Bos taurus [TaxId:9913]
    Gene: SAG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ugxd1, d3ugxd2
  • Heterogens: PTD, NA, EDO, IMD, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ugxA (A:)
    aswshpqfekmkankpapnhvifkkisrdksvtiylgkrdyidhvervepvdgvvlvdpe
    lvkgkrvyvsltcafrygqedidvmglsfrrdlyfsqvqvfppvgasgattrlqeslikk
    lgantypflltfpdylpcsvmlqpapqdvgkscgvdfeikafathstdveedkipkkssv
    rllirkvqhaprdmgpqpraeaswqffmsdkplrlavslskeiyyhgepipvtvavtnst
    ektvkkikvlveqvtnvvlyssdyyiktvaaeeaqekvppnssltktltlvpllannrer
    rgialdgkikhedtnlasstiikegidktvmgilvsyqikvkltvsgllgeltssevate
    vpfrlmhpqpedpdtakesfqdenfvfeefarqnlkdageykeektdqeaamde
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ugxA (A:)
    nhvifkkisrdksvtiylgkrdyidhvervepvdgvvlvdpelvkgkrvyvsltcafryg
    qedidvmglsfrrdlyfsqvqvfppvgasgattrlqeslikklgantypflltfpdylpc
    svmlqpapqdvgkscgvdfeikafathstdveedkipkkssvrllirkvqhaprdmgpqp
    raeaswqffmsdkplrlavslskeiyyhgepipvtvavtnstektvkkikvlveqvtnvv
    lyssdyyiktvaaeeaqekvppnssltktltlvpllannrerrgialdgkikhedtnlas
    stiikegidktvmgilvsyqikvkltvsgllgeltssevatevpfrlmhpqpeddenfvf
    eefarqnlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ugxB (B:)
    aswshpqfekmkankpapnhvifkkisrdksvtiylgkrdyidhvervepvdgvvlvdpe
    lvkgkrvyvsltcafrygqedidvmglsfrrdlyfsqvqvfppvgasgattrlqeslikk
    lgantypflltfpdylpcsvmlqpapqdvgkscgvdfeikafathstdveedkipkkssv
    rllirkvqhaprdmgpqpraeaswqffmsdkplrlavslskeiyyhgepipvtvavtnst
    ektvkkikvlveqvtnvvlyssdyyiktvaaeeaqekvppnssltktltlvpllannrer
    rgialdgkikhedtnlasstiikegidktvmgilvsyqikvkltvsgllgeltssevate
    vpfrlmhpqpedpdtakesfqdenfvfeefarqnlkdageykeektdqeaamde
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ugxB (B:)
    vifkkisrdksvtiylgkrdyidhvervepvdgvvlvdpelvkgkrvyvsltcafrygqe
    didvmglsfrrdlyfsqvqvfppvggattrlqeslikklgantypflltfpdylpcsvml
    qpapqdvgkscgvdfeikafathstdvipkkssvrllirkvqhaprdmgpqpraeaswqf
    fmsdkplrlavslskeiyyhgepipvtvavtnstektvkkikvlveqvtnvvlyssdyyi
    ktvaaeeaqekvppnssltktltlvpllannrerrgialdgkikhedtnlasstiikegi
    dktvmgilvsyqikvkltvsgltssevatevpfrlmhpqpedvfeefarqnl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ugxC (C:)
    aswshpqfekmkankpapnhvifkkisrdksvtiylgkrdyidhvervepvdgvvlvdpe
    lvkgkrvyvsltcafrygqedidvmglsfrrdlyfsqvqvfppvgasgattrlqeslikk
    lgantypflltfpdylpcsvmlqpapqdvgkscgvdfeikafathstdveedkipkkssv
    rllirkvqhaprdmgpqpraeaswqffmsdkplrlavslskeiyyhgepipvtvavtnst
    ektvkkikvlveqvtnvvlyssdyyiktvaaeeaqekvppnssltktltlvpllannrer
    rgialdgkikhedtnlasstiikegidktvmgilvsyqikvkltvsgllgeltssevate
    vpfrlmhpqpedpdtakesfqdenfvfeefarqnlkdageykeektdqeaamde
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ugxC (C:)
    nhvifkkisrdksvtiylgkrdyidhvervepvdgvvlvdpelvkgkrvyvsltcafryg
    qlsfrrdlyfsqvqvfppvgasgattrlqeslikklgantypflltfpdylpcsvmlqpa
    pqdvgkscgvdfeikafathstdveedkipkkssvrllirkvqhaprdmgpqpraeaswq
    ffmsdkplrlavslskeiyyhgepipvtvavtnstektvkkikvlveqvtnvvlyssdyy
    iktvaaeeaqekvppnssltktltlvpllannrerrgialdgkikhedtnlasstiikeg
    idktvmgilvsyqikvkltvsgllssevatevpfrlmhpqpeddenfvfeefarqnlk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ugxD (D:)
    aswshpqfekmkankpapnhvifkkisrdksvtiylgkrdyidhvervepvdgvvlvdpe
    lvkgkrvyvsltcafrygqedidvmglsfrrdlyfsqvqvfppvgasgattrlqeslikk
    lgantypflltfpdylpcsvmlqpapqdvgkscgvdfeikafathstdveedkipkkssv
    rllirkvqhaprdmgpqpraeaswqffmsdkplrlavslskeiyyhgepipvtvavtnst
    ektvkkikvlveqvtnvvlyssdyyiktvaaeeaqekvppnssltktltlvpllannrer
    rgialdgkikhedtnlasstiikegidktvmgilvsyqikvkltvsgllgeltssevate
    vpfrlmhpqpedpdtakesfqdenfvfeefarqnlkdageykeektdqeaamde
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ugxD (D:)
    nhvifkkisrdksvtiylgkrdyidhvervepvdgvvlvdpelvkgkrvyvsltcafryg
    qedidvmglsfrrdlyfsqvqvfppvttrlqeslikklgantypflltfpdylpcsvmlq
    papqdvgkscgvdfeikafatdkipkkssvrllirkvqhaprdmgpqpraeaswqffmsd
    kplrlavslskeiyyhgepipvtvavtnstektvkkikvlveqvtnvvlyssdyyiktva
    aeeaqekvppnssltktltlvpllannrerrgialdgkikhedtnlasstiikegidktv
    mgilvsyqikvkltvsgtssevatevpfrlmhpqpenfvfeefarqnl