PDB entry 3ugq

View 3ugq on RCSB PDB site
Description: Crystal structure of the apo form of the yeast mitochondrial threonyl-tRNA synthetase determined at 2.1 Angstrom resolution
Class: ligase
Keywords: tRNA, threonyl-tRNA synthetase, threonine tRNA, aminoacyl-tRNA synthetase class II, LIGASE
Deposited on 2011-11-02, released 2012-02-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.208
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Threonyl-tRNA synthetase, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: MST1, YKL194C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ugqa1, d3ugqa2
  • Heterogens: ZN, SO4, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ugqA (A:)
    mgsshhhhhhssglvprgshmasatknassatpatmtsmvsqrqdlfmtdplspgsmffl
    pngakifnkliefmklqqkfkfgfnevvtpliykktlweksghwenyaddmfkvettdee
    keeyglkpmncpghclifgkkdrsynelplrfsdfsplhrneasgalsgltrlrkfhqdd
    ghifctpsqvkseifnslklidivynkifpfvkggsgaesnyfinfstrpdhfigdlkvw
    nhaeqvlkeileesgkpwklnpgdgafygpkldimvtdhlrkthqvatiqldfqlperfd
    lkfkdqdnsykrpimihratfgsierfmallidsnegrwpfwlnpyqaviipvntknvqq
    ldmctalqkklrneleaddmepvplndwhfnvdldirnepvgyriksailknysyliivg
    deevqlqkynirerdnrksfekltmsqiwekfieleknyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ugqA (A:)
    atpatmtsmvsqrqdlfmtdplspgsmfflpngakifnkliefmklqqkfkfgfnevvtp
    liykktlweksghwenyaddmfkvettdeekeeyglkpmncpghclifgkkdrsynelpl
    rfsdfsplhrneasgalsgltrlrkfhqddghifctpsqvkseifnslklidivynkifp
    fvgaesnyfinfstrpdhfigdlkvwnhaeqvlkeileesgkpwklnpgdgafygpkldi
    mvtdhlrkthqvatiqldfqlperfdlkfkdqdnsykrpimihratfgsierfmallids
    negrwpfwlnpyqaviipvntknvqqldmctalqkklrneleaddmepvplndwhfnvdl
    dirnepvgyriksailknysyliivgdeevqlqkynirerdnrksfekltmsqiwekfie
    leknyk