PDB entry 3ugi

View 3ugi on RCSB PDB site
Description: Structural and functional characterization of an anesthetic binding site in the second cysteine-rich domain of protein kinase C delta
Class: metal binding protein
Keywords: Proteine kinase C delta, PHOSPHOTRANSFERASE, anesthetic binding site, METAL BINDING PROTEIN
Deposited on 2011-11-02, released 2012-12-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.36 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein kinase c delta type
    Species: Mus musculus [TaxId:10090]
    Gene: Prkcd, Pkcd
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28867 (9-58)
      • expression tag (0-8)
      • expression tag (59-64)
    Domains in SCOPe 2.08: d3ugia1, d3ugia2, d3ugia3
  • Chain 'B':
    Compound: protein kinase c delta type
    Species: Mus musculus [TaxId:10090]
    Gene: Prkcd, Pkcd
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28867 (9-58)
      • expression tag (0-8)
      • expression tag (59-64)
    Domains in SCOPe 2.08: d3ugib1, d3ugib2, d3ugib3
  • Heterogens: ZN, 09U, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ugiA (A:)
    gsrrasvgshrfkvynymsptfcdhcgsllwglvkqglkcedcgmnvhhkcrekvanlce
    fivtd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ugiB (B:)
    gsrrasvgshrfkvynymsptfcdhcgsllwglvkqglkcedcgmnvhhkcrekvanlce
    fivtd