PDB entry 3ugd

View 3ugd on RCSB PDB site
Description: Structural and functional characterization of an anesthetic binding site in the second cysteine-rich domain of protein kinase C delta
Class: metal binding protein
Keywords: Proteine kinase C delta, PHOSPHOTRANSFERASE, Anesthetic binding site, METAL BINDING PROTEIN
Deposited on 2011-11-02, released 2012-12-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-08-28, with a file datestamp of 2013-08-23.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.177
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein kinase c delta type
    Species: Mus musculus [TaxId:10090]
    Gene: Prkcd, Pkcd
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28867 (9-58)
      • expression tag (0-8)
      • engineered mutation (14)
      • expression tag (59-64)
    Domains in SCOPe 2.06: d3ugda1, d3ugda2, d3ugda3
  • Chain 'B':
    Compound: protein kinase c delta type
    Species: Mus musculus [TaxId:10090]
    Gene: Prkcd, Pkcd
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28867 (9-58)
      • expression tag (0-8)
      • engineered mutation (14)
      • expression tag (59-64)
    Domains in SCOPe 2.06: d3ugdb1, d3ugdb2, d3ugdb3
  • Heterogens: ZN, EDO, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ugdA (A:)
    gsrrasvgshrfkvhnymsptfcdhcgsllwglvkqglkcedcgmnvhhkcrekvanlce
    fivtd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ugdB (B:)
    gsrrasvgshrfkvhnymsptfcdhcgsllwglvkqglkcedcgmnvhhkcrekvanlce
    fivtd