PDB entry 3uff

View 3uff on RCSB PDB site
Description: Structural and functional characterization of an anesthetic binding site in the second cysteine-rich domain of protein kinase Cdelta
Class: metal binding protein
Keywords: Proteine kinase Cdelta, phosphotransferase, anesthetic binding site, METAL BINDING PROTEIN
Deposited on 2011-11-01, released 2012-12-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-08-28, with a file datestamp of 2013-08-23.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.152
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein kinase c delta type
    Species: Mus musculus [TaxId:10090]
    Gene: Prkcd, Pkcd
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28867 (9-58)
      • expression tag (0-8)
      • engineered mutation (14)
      • expression tag (59-64)
    Domains in SCOPe 2.06: d3uffa1, d3uffa2, d3uffa3
  • Chain 'B':
    Compound: protein kinase c delta type
    Species: Mus musculus [TaxId:10090]
    Gene: Prkcd, Pkcd
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28867 (9-58)
      • expression tag (0-8)
      • engineered mutation (14)
      • expression tag (59-64)
    Domains in SCOPe 2.06: d3uffb1, d3uffb2, d3uffb3
  • Heterogens: ZN, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3uffA (A:)
    gsrrasvgshrfkvtnymsptfcdhcgsllwglvkqglkcedcgmnvhhkcrekvanlce
    fivtd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3uffB (B:)
    gsrrasvgshrfkvtnymsptfcdhcgsllwglvkqglkcedcgmnvhhkcrekvanlce
    fivtd