PDB entry 3uf9

View 3uf9 on RCSB PDB site
Description: Crystal structure of SsoPox in complex with the phosphotriester fensulfothion
Class: hydrolase
Keywords: (Beta/alpha)8-hydrolase, Lactonase, HYDROLASE
Deposited on 2011-10-31, released 2012-10-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-11-06, with a file datestamp of 2013-11-01.
Experiment type: XRAY
Resolution: 2.68 Å
R-factor: 0.241
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aryldialkylphosphatase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: php, SSO2522
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3uf9a_
  • Chain 'B':
    Compound: aryldialkylphosphatase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: php, SSO2522
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3uf9b_
  • Chain 'C':
    Compound: aryldialkylphosphatase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: php, SSO2522
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3uf9c_
  • Chain 'D':
    Compound: aryldialkylphosphatase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: php, SSO2522
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3uf9d_
  • Heterogens: FE2, CO, FST, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3uf9A (A:)
    mriplvgkdsieskdigftlihehlrvfseavrqqwphlynedeefrnavnevkramqfg
    vktivdptvmglgrdirfmekvvkatginlvagtgiyiyidlpfyflnrsideiadlfih
    dikegiqgtlnkagfvkiaadepgitkdvekviraaaianketkvpiithsnahnntgle
    qqrilteegvdpgkilighlgdtdnidyikkiadkgsfigldrygldlflpvdkrnettl
    rlikdgysdkimishdycctidwgtakpeykpklaprwsitlifedtipflkrngvneev
    iatifkenpkkffs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3uf9B (B:)
    mriplvgkdsieskdigftlihehlrvfseavrqqwphlynedeefrnavnevkramqfg
    vktivdptvmglgrdirfmekvvkatginlvagtgiyiyidlpfyflnrsideiadlfih
    dikegiqgtlnkagfvkiaadepgitkdvekviraaaianketkvpiithsnahnntgle
    qqrilteegvdpgkilighlgdtdnidyikkiadkgsfigldrygldlflpvdkrnettl
    rlikdgysdkimishdycctidwgtakpeykpklaprwsitlifedtipflkrngvneev
    iatifkenpkkffs
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3uf9C (C:)
    mriplvgkdsieskdigftlihehlrvfseavrqqwphlynedeefrnavnevkramqfg
    vktivdptvmglgrdirfmekvvkatginlvagtgiyiyidlpfyflnrsideiadlfih
    dikegiqgtlnkagfvkiaadepgitkdvekviraaaianketkvpiithsnahnntgle
    qqrilteegvdpgkilighlgdtdnidyikkiadkgsfigldrygldlflpvdkrnettl
    rlikdgysdkimishdycctidwgtakpeykpklaprwsitlifedtipflkrngvneev
    iatifkenpkkffs
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3uf9D (D:)
    mriplvgkdsieskdigftlihehlrvfseavrqqwphlynedeefrnavnevkramqfg
    vktivdptvmglgrdirfmekvvkatginlvagtgiyiyidlpfyflnrsideiadlfih
    dikegiqgtlnkagfvkiaadepgitkdvekviraaaianketkvpiithsnahnntgle
    qqrilteegvdpgkilighlgdtdnidyikkiadkgsfigldrygldlflpvdkrnettl
    rlikdgysdkimishdycctidwgtakpeykpklaprwsitlifedtipflkrngvneev
    iatifkenpkkffs