PDB entry 3uf4

View 3uf4 on RCSB PDB site
Description: Crystal structure of a SH3 and SH2 domains of FYN protein (Proto-concogene Tyrosine-protein kinase Fyn) from Mus musculus at 1.98 A resolution
Class: transferase
Keywords: Phosphorylation, Host-virus interaction, Protein-Tyrosine Kinases, src Homology Domains, src-Family Kinases, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-BIOLOGY, TRANSFERASE, Partnership for T-Cell Biology
Deposited on 2011-10-31, released 2011-12-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-10-21, with a file datestamp of 2015-10-16.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase Fyn, Isoform 2
    Species: Mus musculus [TaxId:10090]
    Gene: BC092217, Fyn
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39688 (Start-163)
      • conflict (98)
    Domains in SCOPe 2.06: d3uf4a1, d3uf4a2
  • Heterogens: NA, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3uf4A (A:)
    gtgvtlfvalydyearteddlsfhkgekfqilnssegdwwearslttgetgyipsnyvap
    vdsiqaeewyfgklgrkdaerqllsfgnprgtfliresettkgayslsirdwddmkgdhv
    khykirkldnggyyittraqfetlqqlvqhysekadglcfnltv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uf4A (A:)
    tlfvalydyearteddlsfhkgekfqilnssegdwwearslttgetgyipsnyvapvdsi
    qaeewyfgklgrkdaerqllsfgnprgtfliresettkgayslsirdwddmkgdhvkhyk
    irkldnggyyittraqfetlqqlvqhysekadglcfnltv