SCOPe 2.03: Structural Classification of Proteins

PDB entry 3uex

View 3uex on RCSB PDB site
Description: Bovine beta-lactoglobulin complex with stearic acid
Class: transport protein
Keywords: beta protein, beta barrel, lipocalin, bovine milk, TRANSPORT PROTEIN
Deposited on 2011-10-31, released 2011-11-09
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-06-20, with a file datestamp of 2012-06-15.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.235
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: beta-lactoglobulin
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
- Uniprot P02754 (0-161)
Domains in SCOPe 2.03: d3uexa_
Heterogens: STE, EOH, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>3uexA (A:)
livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
wengecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacq
clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi

Sequence, based on observed residues (ATOM records): (download)

>3uexA (A:)
livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
wengecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmenpeqslacqclv
rtpevddealekfdkalkalpmhirlsfnptqleeqchi