PDB entry 3ueq

View 3ueq on RCSB PDB site
Description: Crystal structure of amylosucrase from Neisseria polysaccharea in complex with turanose
Class: transferase
Keywords: beta/alpha-barrel, glycoside hydrolase, amylose synthesis, sucrose isomerization, glucosyltransferase, carbohydrate, TRANSFERASE
Deposited on 2011-10-31, released 2012-01-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-03-14, with a file datestamp of 2012-03-09.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.149
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amylosucrase
    Species: Neisseria polysaccharea [TaxId:489]
    Gene: ams
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZEU2 (8-631)
      • expression tag (0-7)
      • see remark 999 (540)
    Domains in SCOPe 2.06: d3ueqa1, d3ueqa2, d3ueqa3
  • Heterogens: BTU, OTU, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ueqA (A:)
    gplgspnsqylktrildiytpeqragieksedwrqfsrrmdthfpklmneldsvygnnea
    llpmlemllaqawqsysqrnsslkdidiarennpdwilsnkqvggvcyvdlfagdlkglk
    dkipyfqelgltylhlmplfkcpegksdggyavssyrdvnpalgtigdlreviaalheag
    isavvdfifnhtsnehewaqrcaagdplfdnfyyifpdrrmpdqydrtlreifpdqhpgg
    fsqledgrwvwttfnsfqwdlnysnpwvframagemlflanlgvdilrmdavafiwkqmg
    tscenlpqahalirafnavmriaapavffkseaivhpdqvvqyigqdecqigynplqmal
    lwntlatrevnllhqaltyrhnlpehtawvnyvrshddigwtfadedaaylgisgydhrq
    flnrffvnrfdgsfargvpfqynpstgdcrvsgtaaalvglaqddphavdrikllysial
    stgglpliylgdevgtlndddwsqdsnksddsrwahrprynealyaqrndpstaagqiyq
    dlrhmiavrqsnprfdggrlvtfntnnkhiigyirnnallafgnfseypqtvtahtlqam
    pfkahdliggktvslnqdltlqpyqvmwleia