PDB entry 3ue4

View 3ue4 on RCSB PDB site
Description: Structural and spectroscopic analysis of the kinase inhibitor bosutinib binding to the Abl tyrosine kinase domain
Class: transferase/transferase inhibitor
Keywords: Protein Kinase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2011-10-28, released 2012-04-18
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-04-25, with a file datestamp of 2012-04-20.
Experiment type: XRAY
Resolution: 2.42 Å
R-factor: 0.192
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase ABL1
    Species: Homo sapiens [TaxId:9606]
    Gene: ABL1, ABL, JTK7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ue4a_
  • Chain 'B':
    Compound: Tyrosine-protein kinase ABL1
    Species: Homo sapiens [TaxId:9606]
    Gene: ABL1, ABL, JTK7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ue4b_
  • Heterogens: DB8, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ue4A (A:)
    ghmspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflk
    eaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymat
    qissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikw
    tapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcp
    ekvyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ue4A (A:)
    dkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaavmke
    ikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymatqissame
    ylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapesla
    ynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelm
    racwqwnpsdrpsfaeihqafetmfqessi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ue4B (B:)
    ghmspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflk
    eaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymat
    qissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikw
    tapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcp
    ekvyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ue4B (B:)
    dkwemertditmkhklggggevyegvwkkysltvavktlkedtmeveeflkeaavmkeik
    hpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymatqissameyl
    ekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapeslayn
    kfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelmra
    cwqwnpsdrpsfaeihqafetmfqessi